Comparing AZOBR_RS04075 FitnessBrowser__azobra:AZOBR_RS04075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
36% identity, 95% coverage: 18:420/426 of query aligns to 5:406/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
36% identity, 95% coverage: 18:420/426 of query aligns to 5:406/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
32% identity, 94% coverage: 20:418/426 of query aligns to 13:407/412 of 4jbeB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
24% identity, 67% coverage: 124:407/426 of query aligns to 108:425/455 of 5j7iC
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
24% identity, 67% coverage: 124:407/426 of query aligns to 109:426/456 of 5j7iB
7w5nA The crystal structure of the reduced form of gluconobacter oxydans wsh-004 sndh (see paper)
25% identity, 50% coverage: 114:326/426 of query aligns to 136:345/492 of 7w5nA
Sites not aligning to the query:
7w5kA The c296a mutant of l-sorbosone dehydrogenase (sndh) from gluconobacter oxydans wsh-004 (see paper)
26% identity, 50% coverage: 114:326/426 of query aligns to 135:344/491 of 7w5kA
Sites not aligning to the query:
3rhhD Crystal structure of NADP-dependent glyceraldehyde-3-phosphate dehydrogenase from bacillus halodurans c-125 complexed with NADP
30% identity, 38% coverage: 122:283/426 of query aligns to 142:302/480 of 3rhhD
Sites not aligning to the query:
4npiA 1.94 angstroms x-ray crystal structure of NAD- and intermediate- bound alpha-aminomuconate-epsilon-semialdehyde dehydrogenase from pseudomonas fluorescens (see paper)
26% identity, 38% coverage: 121:283/426 of query aligns to 138:302/483 of 4npiA
Sites not aligning to the query:
4i2rA 2.15 angstroms x-ray crystal structure of NAD- and alternative substrate-bound 2-aminomuconate 6-semialdehyde dehydrogenase from pseudomonas fluorescens (see paper)
26% identity, 38% coverage: 121:283/426 of query aligns to 138:302/483 of 4i2rA
Sites not aligning to the query:
4i25A 2.00 angstroms x-ray crystal structure of NAD- and substrate-bound 2- aminomuconate 6-semialdehyde dehydrogenase from pseudomonas fluorescens (see paper)
26% identity, 38% coverage: 121:283/426 of query aligns to 138:302/483 of 4i25A
Sites not aligning to the query:
5kj5B Crystal structure of 2-aminomuconate 6-semialdehyde dehydrogenase n169d in complex with NAD+ (see paper)
26% identity, 38% coverage: 121:283/426 of query aligns to 139:303/484 of 5kj5B
Sites not aligning to the query:
5kllA Crystal structure of 2-hydroxymuconate-6-semialdehyde derived tautomeric intermediate in 2-aminomuconate 6-semialdehyde dehydrogenase n169d (see paper)
26% identity, 38% coverage: 121:283/426 of query aligns to 138:302/483 of 5kllA
Sites not aligning to the query:
>AZOBR_RS04075 FitnessBrowser__azobra:AZOBR_RS04075
MSALLETTDALHDQMLALGRAARAAAAELATVPSPSKDQALRAAAAAIRARKAEIQAAND
ADVAAAKDRGLAGPMIERLALNDARIEAMAKGLEDIADFPDPIGGVIAEWTRPNGLAIQR
VRVPLGVIGIIYESRPNVTADAGGLCLKSGNAAILRGGSESIRSSHAIAACLADGLRAAG
LPEAAIQLVPTTDRAAVGHMLTMRDFIDVIVPRGGKSLIQRIAEESRIPVIKHLDGNNTV
YVDAGADPEKARKVVMNAKMRRTSICGAAETLLVDRKIADAMLPVLVKDLLDAGCAVRGD
AAAQAVDPRVTAVTAEDWDTEFLDAIIACGVVDGVDGAIDHINRHGSHHTDAIVTEDPAA
AERFLQRIDSGIVLWNASTQFADGGEFGMGAEIGISTDKFHARGPVGAEQLTSYKYVVRG
DGQTRP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory