SitesBLAST
Comparing AZOBR_RS04080 FitnessBrowser__azobra:AZOBR_RS04080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
31% identity, 88% coverage: 33:285/288 of query aligns to 1:255/418 of 7w2jC
- binding heme c: C13 (= C46), C16 (= C49), H17 (= H50), T42 (≠ S80), I44 (= I82), Y55 (≠ W93), L75 (≠ I113), Y76 (≠ G114), A78 (≠ P116), M79 (= M117), R122 (≠ G161), H161 (= H188), C162 (= C189), C165 (= C192), H166 (= H193), A191 (≠ S223), P192 (≠ R224), R223 (= R256), P227 (= P260), M228 (= M261)
Sites not aligning to the query:
- binding heme c: 289, 290, 293, 294, 305, 306, 307, 309, 312, 313, 314, 322, 327, 331, 333, 340, 342, 343, 345
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
31% identity, 88% coverage: 33:285/288 of query aligns to 1:255/413 of 8jejC
- binding heme c: C13 (= C46), C16 (= C49), H17 (= H50), T42 (≠ S80), I44 (= I82), F60 (≠ L98), L64 (≠ I102), L75 (≠ I113), Y76 (≠ G114), M79 (= M117), P80 (= P118), Y84 (= Y122), R122 (≠ G161), C162 (= C189), C165 (= C192), H166 (= H193), I186 (≠ T215), W189 (= W218), A191 (≠ S223), P192 (≠ R224), I194 (= I226), W205 (= W237), Y213 (≠ A245), R223 (= R256), M228 (= M261)
- binding ubiquinone-10: M36 (≠ P74), P77 (= P115), S124 (≠ P163), W128 (vs. gap), C165 (= C192), L173 (≠ G200)
Sites not aligning to the query:
- binding heme c: 303, 304, 307, 308, 320, 321, 323, 327, 328, 336, 341, 345, 347, 354, 356, 359, 376
- binding ubiquinone-10: 408, 411
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
29% identity, 95% coverage: 11:285/288 of query aligns to 22:304/478 of Q47945
- Q37 (≠ E26) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
30% identity, 89% coverage: 30:285/288 of query aligns to 3:266/433 of 8gy2B
- binding heme c: C18 (= C46), C21 (= C49), H22 (= H50), T46 (≠ S80), I48 (= I82), Y59 (≠ W93), L68 (≠ I102), R73 (= R107), V79 (≠ I113), Y80 (≠ G114), M83 (= M117), F88 (≠ Y122), R126 (vs. gap), H165 (= H188), C166 (= C189), C169 (= C192), H170 (= H193), I201 (≠ V222), A202 (≠ S223), P203 (≠ R224), L205 (≠ I226), W216 (= W237), F224 (≠ A245), A234 (≠ R256), V235 (≠ L257), F236 (≠ S258), F236 (≠ S258), M239 (= M261)
- binding ubiquinone-10: C21 (= C49), L34 (≠ T68), P39 (≠ E73), P81 (= P115), L129 (vs. gap), W132 (vs. gap), E168 (= E191), R173 (≠ M196), I197 (≠ W218), D241 (vs. gap)
Sites not aligning to the query:
- binding heme c: 301, 302, 305, 306, 316, 317, 318, 320, 324, 342, 352, 354, 356, 359, 375, 428
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
32% identity, 57% coverage: 33:195/288 of query aligns to 41:209/440 of 8gy3A
- binding heme c: Y52 (≠ V44), C53 (= C46), C56 (= C49), H57 (= H50), S84 (= S80), I86 (= I82), W97 (= W93), F102 (≠ L98), L117 (≠ I113), F121 (≠ M117), F126 (≠ Y122), R163 (vs. gap), C203 (= C189), C206 (= C192), H207 (= H193)
- binding ubiquinone-10: E55 (≠ N48), T76 (= T68), F78 (= F70), Y118 (≠ G114), P119 (= P115), I160 (vs. gap), G166 (vs. gap), Q167 (≠ K149), F169 (≠ E151), W170 (≠ Y152), H202 (= H188)
Sites not aligning to the query:
- binding heme c: 232, 233, 235, 245, 253, 254, 263, 264, 269, 292, 337, 340, 341, 353, 355, 358, 359, 372, 377, 382, 383, 386, 388, 391
- binding ubiquinone-10: 210, 213
Query Sequence
>AZOBR_RS04080 FitnessBrowser__azobra:AZOBR_RS04080
MVRLVRRGSVAACLMLSGMIATAGAETPPESPVERGRALVNGIVACGNCHTPQGPNGPVA
GRELAGGTPFVEEPFTAYASNITPDPETGIGRWTDEQLIAAIREGRRPDGSLIGPPMPFG
FYRGLSDGDLRAIVAYLRSVPPVRHSVPKSEYRMALPAAYGPPVGSVAEIPRTDPVTYGA
YMAGPLGHCMECHTPMLPDGRLDMTRMGAGGRNFTGPWGNAVSRNITQDKEHGLGGWTDA
EIRKAITEGVRPDGHRLSPPMGYHYYKSMSDGELGALVAYLRTLPPTR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory