Comparing AZOBR_RS04095 FitnessBrowser__azobra:AZOBR_RS04095 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
43% identity, 98% coverage: 7:376/376 of query aligns to 1:365/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
43% identity, 98% coverage: 7:376/376 of query aligns to 3:367/367 of P0A7B5
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 98% coverage: 7:376/376 of query aligns to 1:325/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
38% identity, 98% coverage: 7:376/376 of query aligns to 1:323/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
34% identity, 67% coverage: 9:261/376 of query aligns to 1:240/241 of 2akoA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
37% identity, 63% coverage: 8:243/376 of query aligns to 12:239/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
40% identity, 48% coverage: 8:187/376 of query aligns to 12:185/236 of 7f5xA
7lnuA Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
28% identity, 53% coverage: 8:206/376 of query aligns to 1:200/239 of 7lnuA
7lntA Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
28% identity, 52% coverage: 11:206/376 of query aligns to 4:200/238 of 7lntA
7lnxB I146a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
28% identity, 49% coverage: 11:193/376 of query aligns to 7:193/247 of 7lnxB
Sites not aligning to the query:
7lnxA I146a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
28% identity, 49% coverage: 11:193/376 of query aligns to 2:188/234 of 7lnxA
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
50% identity, 11% coverage: 154:193/376 of query aligns to 121:160/226 of 2bmuB
Sites not aligning to the query:
7n9dA I74a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
28% identity, 49% coverage: 11:193/376 of query aligns to 3:189/253 of 7n9dA
Sites not aligning to the query:
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
50% identity, 11% coverage: 154:193/376 of query aligns to 120:159/225 of Q8U122
Sites not aligning to the query:
7lnuB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
28% identity, 49% coverage: 8:193/376 of query aligns to 2:191/261 of 7lnuB
Sites not aligning to the query:
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
50% identity, 11% coverage: 154:193/376 of query aligns to 122:161/219 of 2ji5A
Sites not aligning to the query:
7lnwA I146a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
28% identity, 49% coverage: 11:193/376 of query aligns to 3:189/256 of 7lnwA
Sites not aligning to the query:
7lntB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
28% identity, 49% coverage: 8:193/376 of query aligns to 1:190/260 of 7lntB
3wwmA Crystal structure of lysz from thermus thermophilus with adp (see paper)
32% identity, 33% coverage: 123:247/376 of query aligns to 140:257/269 of 3wwmA
Sites not aligning to the query:
O50147 [LysW]-aminoadipate kinase; EC 2.7.2.17 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
32% identity, 33% coverage: 123:247/376 of query aligns to 140:257/269 of O50147
Sites not aligning to the query:
>AZOBR_RS04095 FitnessBrowser__azobra:AZOBR_RS04095
LLPTLLDARRLVVKIGSALLVDSATGRMRREWLDALADDVAACRKRGQEVVIVTSGAVAC
GREHLGLVGRALRLEEKQAAAATGQIRLAAAYQETLARHGLTVAQVLVTLEDTEERRRHL
NGRATIDTLLKLGAVPVINENDTVATAEIRFGDNDRLAARVAQMISADTLVLLSDIDGLY
TADPRKDPDARHIPVVQELTSDIENMAGEPPPGYSSGGMVTKIVAARVALAAGCRMVIAK
GKRMNPLAALEQRPEQGGALCTWFLPAASPSSARKAWIGGNLNAHGALTVDAGALSALAR
GASLLPAGVRAVEGDFERGDVVVVKAPDGREVARGLTAYAAEDARRIAGRKSHEIEEILG
YRGRDEMIHRDDLVVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory