Comparing AZOBR_RS04120 FitnessBrowser__azobra:AZOBR_RS04120 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8K4H1 Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 from Mus musculus (Mouse) (see paper)
25% identity, 99% coverage: 1:268/271 of query aligns to 16:301/305 of Q8K4H1
Q04457 Gut esterase 1; Non-specific carboxylesterase; EC 3.1.1.1 from Caenorhabditis elegans (see 2 papers)
35% identity, 39% coverage: 60:166/271 of query aligns to 105:224/562 of Q04457
Sites not aligning to the query:
I4DST8 Tuliposide A-converting enzyme 1, chloroplastic; TgTCEA1; EC 4.2.99.22 from Tulipa gesneriana (Garden tulip) (see paper)
29% identity, 46% coverage: 63:186/271 of query aligns to 145:280/385 of I4DST8
Sites not aligning to the query:
1qz3A Crystal structure of mutant m211s/r215l of carboxylesterase est2 complexed with hexadecanesulfonate (see paper)
32% identity, 43% coverage: 63:178/271 of query aligns to 74:188/309 of 1qz3A
Sites not aligning to the query:
7w1iA Crystal structure of carboxylesterase mutant from thermobifida fusca with c8x and c9c
32% identity, 38% coverage: 57:158/271 of query aligns to 93:201/497 of 7w1iA
Sites not aligning to the query:
7w1jA Crystal structure of carboxylesterase from thermobifida fusca with j1k
32% identity, 38% coverage: 57:158/271 of query aligns to 92:200/494 of 7w1jA
Sites not aligning to the query:
6ieyA Crystal structure of chloramphenicol-metabolizaing enzyme estdl136- chloramphenicol complex (see paper)
31% identity, 48% coverage: 28:158/271 of query aligns to 37:162/307 of 6ieyA
Sites not aligning to the query:
5aobA The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-butyrate bound (see paper)
33% identity, 32% coverage: 65:152/271 of query aligns to 43:132/278 of 5aobA
5aocA The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-valerate bound (see paper)
33% identity, 32% coverage: 65:152/271 of query aligns to 47:136/277 of 5aocA
Sites not aligning to the query:
7bfrA Thermogutta terrifontis esterase 2 phosphorylated by paraoxon (see paper)
33% identity, 32% coverage: 65:152/271 of query aligns to 43:132/260 of 7bfrA
Sites not aligning to the query:
1c7iA Thermophylic pnb esterase (see paper)
36% identity, 39% coverage: 49:153/271 of query aligns to 75:199/483 of 1c7iA
Sites not aligning to the query:
P37967 Para-nitrobenzyl esterase; Intracellular esterase B; PNB carboxy-esterase; PNBCE; EC 3.1.1.- from Bacillus subtilis (strain 168) (see paper)
37% identity, 39% coverage: 49:153/271 of query aligns to 76:200/489 of P37967
1qe3A Pnb esterase (see paper)
36% identity, 39% coverage: 49:153/271 of query aligns to 66:190/467 of 1qe3A
Sites not aligning to the query:
P95125 Carboxylic ester hydrolase LipN; EC 3.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 38% coverage: 57:158/271 of query aligns to 128:232/376 of P95125
Sites not aligning to the query:
O00748 Cocaine esterase; Carboxylesterase 2; CE-2; hCE-2; Methylumbelliferyl-acetate deacetylase 2; EC 3.1.1.84; EC 3.1.1.1; EC 3.1.1.56 from Homo sapiens (Human) (see 4 papers)
36% identity, 35% coverage: 59:152/271 of query aligns to 137:238/559 of O00748
Sites not aligning to the query:
2xmgA G117h mutant of human butyrylcholinesterase in complex with vx (see paper)
35% identity, 32% coverage: 57:144/271 of query aligns to 100:198/527 of 2xmgA
Sites not aligning to the query:
2xmcA G117h mutant of human butyrylcholinesterase in complex with fluoride anion (see paper)
35% identity, 32% coverage: 57:144/271 of query aligns to 100:198/527 of 2xmcA
Sites not aligning to the query:
2xmbA G117h mutant of human butyrylcholinesterase in complex with sulfate (see paper)
35% identity, 32% coverage: 57:144/271 of query aligns to 100:198/527 of 2xmbA
Sites not aligning to the query:
Q6UWW8 Carboxylesterase 3; Liver carboxylesterase 31 homolog; EC 3.1.1.1 from Homo sapiens (Human) (see paper)
38% identity, 35% coverage: 57:152/271 of query aligns to 136:239/571 of Q6UWW8
Sites not aligning to the query:
5tymA Alpha-esterase-7 in complex with [3-bromo-5-(pyrrolidin-1-yl) phenyl]borinic acid (see paper)
30% identity, 39% coverage: 63:167/271 of query aligns to 124:241/566 of 5tymA
Sites not aligning to the query:
>AZOBR_RS04120 FitnessBrowser__azobra:AZOBR_RS04120
MTAAEIDRQYNFRKLVPEHPAYFARWQAESEAVRARLNGRYDVPTGPHPRQRADVFPAGE
GAPVLVFIHGGYWRALSKDLHSFIAAPYVERGVAVVLLGYGLCSEVTMDELCGHAQAGLD
WVIANAAGFGGDPRRVVVSGHSAGGHLTAKLVSENRDRVAGGIPISGLYDLEPMLGFEVN
EQLRLDPDSARRLSPIHAVPTPAPLLMPALGGLETDAMHRQQADYALAWAAQGNAVREIV
EPGADHFSVVDRFAEPGSLLFEAALAMLKDR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory