Comparing AZOBR_RS04130 FitnessBrowser__azobra:AZOBR_RS04130 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 96% coverage: 5:246/252 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 96% coverage: 5:247/252 of query aligns to 4:254/254 of 1g6hA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
34% identity, 97% coverage: 6:249/252 of query aligns to 3:238/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
34% identity, 97% coverage: 6:249/252 of query aligns to 3:238/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
33% identity, 97% coverage: 6:249/252 of query aligns to 4:239/241 of 6mbnA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
34% identity, 96% coverage: 6:246/252 of query aligns to 3:235/235 of 6mhzA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 97% coverage: 5:249/252 of query aligns to 2:238/240 of 6mjpA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
34% identity, 95% coverage: 6:245/252 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
34% identity, 95% coverage: 6:245/252 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
33% identity, 95% coverage: 6:244/252 of query aligns to 3:233/233 of 6b8bA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
32% identity, 98% coverage: 5:250/252 of query aligns to 4:239/285 of 4yerA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 94% coverage: 3:238/252 of query aligns to 15:239/378 of P69874
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 93% coverage: 4:238/252 of query aligns to 1:227/241 of 4u00A
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
31% identity, 89% coverage: 22:246/252 of query aligns to 19:240/253 of 6z5uK
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
31% identity, 89% coverage: 22:246/252 of query aligns to 21:242/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
31% identity, 89% coverage: 22:246/252 of query aligns to 21:242/263 of 7d08B
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 87% coverage: 20:239/252 of query aligns to 15:220/348 of 3d31A
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 91% coverage: 5:234/252 of query aligns to 1:223/240 of 4ymuJ
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
30% identity, 98% coverage: 1:246/252 of query aligns to 2:238/240 of 1ji0A
8f5bA Human abca4 structure in complex with amp-pnp
31% identity, 92% coverage: 4:236/252 of query aligns to 719:941/1924 of 8f5bA
Sites not aligning to the query:
>AZOBR_RS04130 FitnessBrowser__azobra:AZOBR_RS04130
VSAPLLSTNGLVKRFGGLAATDGLSLSVAEGELHALIGPNGAGKTTLIGQLSGELTPDSG
TIRFDRRDVTRLPVHKRAQRGLARSFQITSIFPSFTALDNVALAVQAHAGHSFRFWRDAG
RDRRLADPARAVLERVGLGARADTRADALAHGEKRQLELAMALATGPRLLLLDEPMAGMG
PEDSARMVELLQELKGGVTILLVEHDMDAVFALADRITVLVRGKNLASGTPEQIRNDPAV
REAYLGDELEVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory