SitesBLAST
Comparing AZOBR_RS04215 FitnessBrowser__azobra:AZOBR_RS04215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5khaA Structure of glutamine-dependent NAD+ synthetase from acinetobacter baumannii in complex with adenosine diphosphate (adp)
46% identity, 99% coverage: 5:550/554 of query aligns to 3:522/526 of 5khaA
- active site: D291 (= D298), E397 (= E404)
- binding adenosine-5'-diphosphate: Y273 (= Y280), F279 (= F286), N368 (= N375), R372 (= R379), M379 (= M386), S382 (= S389), N383 (= N390), C403 (≠ A410), T404 (= T411), Y494 (= Y522), K495 (= K523)
2e18A Crystal structure of project ph0182 from pyrococcus horikoshii ot3
34% identity, 47% coverage: 270:531/554 of query aligns to 6:248/256 of 2e18A
Sites not aligning to the query:
P9WJJ3 Glutamine-dependent NAD(+) synthetase; NAD(+) synthase [glutamine-hydrolyzing]; EC 6.3.5.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
27% identity, 95% coverage: 7:532/554 of query aligns to 14:606/679 of P9WJJ3
- E52 (= E45) mutation to A: Lack of glutamine-dependent activity. Retains 30% of ammonia-dependent activity.
- K121 (= K114) mutation to A: Lack of glutamine-dependent and ammonia-dependent activities.
- C176 (= C150) mutation to A: Lack of glutamine-dependent activity. Retains 90% of ammonia-dependent activity.
Sites not aligning to the query:
- 656 D→A: Causes a decrease in ammonia channel efficiency to 70% compared with wild-type enzyme.
6ofcB Crystal structure of m. Tuberculosis glutamine-dependent NAD+ synthetase complexed with sulfonamide derivative 1, pyrophosphate, and glutamine (see paper)
27% identity, 95% coverage: 7:532/554 of query aligns to 14:596/669 of 6ofcB
- binding pyrophosphate 2-: S368 (= S294), G370 (= G296), S373 (= S299), E543 (≠ T476)
- binding 5'-O-[(pyridine-3-carbonyl)sulfamoyl]adenosine: R354 (≠ Y280), L358 (≠ N284), G366 (= G292), V367 (≠ L293), S368 (= S294), A398 (≠ M319), L399 (≠ M320), R452 (= R381), G465 (≠ P394), I466 (≠ M395), T470 (= T399), W480 (≠ Y409), S481 (≠ A410), T482 (= T411), T482 (= T411), Y483 (≠ L412), D487 (= D415), H491 (≠ G419)
Sites not aligning to the query:
3dlaA X-ray crystal structure of glutamine-dependent NAD+ synthetase from mycobacterium tuberculosis bound to naad+ and don (see paper)
28% identity, 84% coverage: 7:469/554 of query aligns to 15:535/651 of 3dlaA
- binding nicotinic acid adenine dinucleotide: R355 (≠ Y280), L359 (≠ N284), G462 (≠ P394), E472 (= E404), W477 (≠ Y409), S478 (≠ A410), T479 (= T411), Y480 (≠ L412), D484 (= D415), H488 (≠ G419)
- binding 5-oxo-l-norleucine: Y128 (= Y120), F131 (= F123), C177 (= C150), E178 (= E151), F181 (≠ W154)
Sites not aligning to the query:
3dlaB X-ray crystal structure of glutamine-dependent NAD+ synthetase from mycobacterium tuberculosis bound to naad+ and don (see paper)
27% identity, 83% coverage: 7:468/554 of query aligns to 14:530/649 of 3dlaB
- binding nicotinic acid adenine dinucleotide: L358 (≠ N284), G458 (≠ P394), W473 (≠ Y409), S474 (≠ A410), T475 (= T411), D480 (= D415), H484 (≠ G419)
- binding 5-oxo-l-norleucine: C176 (= C150), F180 (≠ W154), S201 (≠ N174), S203 (= S176), R209 (≠ K182), Y230 (≠ N205)
Sites not aligning to the query:
6ofcC Crystal structure of m. Tuberculosis glutamine-dependent NAD+ synthetase complexed with sulfonamide derivative 1, pyrophosphate, and glutamine (see paper)
27% identity, 78% coverage: 7:437/554 of query aligns to 14:515/665 of 6ofcC
- binding glutamine: Y58 (= Y51), K121 (= K114), P125 (= P118), F130 (= F123), A176 (≠ C150), E177 (= E151), F180 (≠ W154)
- binding 5'-O-[(pyridine-3-carbonyl)sulfamoyl]adenosine: R354 (≠ Y280), L358 (≠ N284), G366 (= G292), V367 (≠ L293), S368 (= S294), S373 (= S299), F397 (≠ V318), A398 (≠ M319), L399 (≠ M320), R458 (= R381), N467 (= N390), G471 (≠ P394), T476 (= T399), W486 (≠ Y409), S487 (≠ A410), T488 (= T411), Y489 (≠ L412), H497 (≠ G419)
Sites not aligning to the query:
3sytA Crystal structure of glutamine-dependent NAD+ synthetase from m. Tuberculosis bound to amp/ppi, NAD+, and glutamate (see paper)
28% identity, 83% coverage: 7:468/554 of query aligns to 14:541/660 of 3sytA
- binding adenosine monophosphate: G366 (= G292), V367 (≠ L293), S368 (= S294), S373 (= S299), L399 (≠ S322), R456 (= R381), T474 (= T399)
- binding glutamic acid: Y127 (= Y120), F180 (≠ W154), S203 (= S176), R209 (≠ K182)
- binding nicotinamide-adenine-dinucleotide: R354 (≠ Y280), L358 (≠ N284), N450 (= N375), N465 (= N390), G469 (≠ P394), E479 (= E404), W484 (≠ Y409), S485 (≠ A410), T486 (= T411), Y487 (≠ L412), D491 (= D415), H495 (≠ G419)
- binding pyrophosphate 2-: S368 (= S294), G370 (= G296), L371 (≠ I297), D372 (= D298), S373 (= S299)
Sites not aligning to the query:
3sytD Crystal structure of glutamine-dependent NAD+ synthetase from m. Tuberculosis bound to amp/ppi, NAD+, and glutamate (see paper)
27% identity, 78% coverage: 7:437/554 of query aligns to 14:503/649 of 3sytD
- binding adenosine monophosphate: G366 (= G292), V367 (≠ L293), S368 (= S294), A398 (≠ P321), L399 (≠ S322), R446 (= R381)
- binding glutamic acid: Y127 (= Y120), E177 (= E151), F180 (≠ W154), S203 (= S176)
- binding nicotinamide-adenine-dinucleotide: R354 (≠ Y280), L358 (≠ N284), N455 (= N390), G459 (≠ P394), E469 (= E404), W474 (≠ Y409), T476 (= T411), Y477 (≠ L412), D481 (= D415), H485 (≠ G419)
- binding pyrophosphate 2-: S368 (= S294), G370 (= G296), L371 (≠ I297), D372 (= D298), S373 (= S299)
Sites not aligning to the query:
3seqA Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with ampcpp and naad+ (see paper)
27% identity, 83% coverage: 7:468/554 of query aligns to 15:542/661 of 3seqA
- binding diphosphomethylphosphonic acid adenosyl ester: G367 (= G292), V368 (≠ L293), S369 (= S294), G371 (= G296), L372 (≠ I297), D373 (= D298), S374 (= S299), L400 (≠ S322), R457 (= R381), T475 (= T399)
- binding nicotinic acid adenine dinucleotide: R355 (≠ Y280), L359 (≠ N284), V447 (≠ A371), N466 (= N390), G470 (≠ P394), E480 (= E404), W485 (≠ Y409), T487 (= T411), Y488 (≠ L412), D492 (= D415), H496 (≠ G419)
Sites not aligning to the query:
3sezA Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with atp and naad+ (see paper)
27% identity, 84% coverage: 7:469/554 of query aligns to 14:542/658 of 3sezA
- binding adenosine-5'-triphosphate: G366 (= G292), V367 (≠ L293), S368 (= S294), S373 (= S299), A398 (≠ P321), L399 (≠ S322), R456 (= R381), T474 (= T399)
- binding nicotinic acid adenine dinucleotide: R354 (≠ Y280), L358 (≠ N284), N465 (= N390), G469 (≠ P394), E479 (= E404), W484 (≠ Y409), S485 (≠ A410), T486 (= T411), Y487 (≠ L412), D491 (= D415), H495 (≠ G419)
Sites not aligning to the query:
3sezC Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with atp and naad+ (see paper)
27% identity, 78% coverage: 7:437/554 of query aligns to 14:502/648 of 3sezC
- binding adenosine-5'-triphosphate: G366 (= G292), V367 (≠ L293), S368 (= S294), S373 (= S299), A398 (≠ M319), L399 (≠ M320), R445 (= R381), T463 (= T399)
- binding nicotinic acid adenine dinucleotide: L358 (≠ N284), N454 (= N390), G458 (≠ P394), E468 (= E404), W473 (≠ Y409), S474 (≠ A410), T475 (= T411), Y476 (≠ L412), D480 (= D415), H484 (≠ G419)
Sites not aligning to the query:
3seqD Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with ampcpp and naad+ (see paper)
27% identity, 78% coverage: 7:437/554 of query aligns to 15:504/650 of 3seqD
- binding diphosphomethylphosphonic acid adenosyl ester: G367 (= G292), V368 (≠ L293), S369 (= S294), G371 (= G296), L372 (≠ I297), D373 (= D298), S374 (= S299), A399 (≠ P321), L400 (≠ S322), R447 (= R381), T465 (= T399)
- binding nicotinic acid adenine dinucleotide: R355 (≠ Y280), L359 (≠ N284), N456 (= N390), G460 (≠ P394), W475 (≠ Y409), S476 (≠ A410), T477 (= T411), Y478 (≠ L412), D482 (= D415), H486 (≠ G419)
Sites not aligning to the query:
3fiuA Structure of nmn synthetase from francisella tularensis (see paper)
32% identity, 39% coverage: 273:487/554 of query aligns to 11:206/238 of 3fiuA
- binding adenosine monophosphate: G30 (= G292), L31 (= L293), S32 (= S294), L56 (≠ M320), R113 (= R381), T131 (= T399), D147 (= D415), S182 (≠ T464)
- binding magnesium ion: D36 (= D298), E136 (= E404)
- binding pyrophosphate 2-: S32 (= S294), G34 (= G296), I35 (= I297), D36 (= D298), S37 (= S299), K160 (= K428), P181 (= P463), S182 (≠ T464)
1xngB Crystal structure of nh3-dependent NAD+ synthetase from helicobacter pylori (see paper)
31% identity, 40% coverage: 270:488/554 of query aligns to 3:206/262 of 1xngB
- active site: D35 (= D298), E135 (= E404)
- binding adenosine-5'-triphosphate: G29 (= G292), L30 (= L293), S31 (= S294), G33 (= G296), L34 (≠ I297), D35 (= D298), S36 (= S299), M56 (= M320), R112 (= R381), T130 (= T399), E135 (= E404), K159 (= K428), S181 (≠ T464)
- binding nicotinic acid adenine dinucleotide: R21 (≠ N284), F23 (= F286), N106 (= N375), Y117 (≠ M386), S120 (= S389), L121 (≠ N390), L126 (≠ M395), Y140 (= Y409), G141 (≠ A410), T142 (= T411), D146 (= D415), A150 (≠ G419), A182 (= A465)
Sites not aligning to the query:
O25096 NH(3)-dependent NAD(+) synthetase; EC 6.3.1.5 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
30% identity, 40% coverage: 266:488/554 of query aligns to 1:208/260 of O25096
- 31:38 (vs. 292:299, 88% identical) binding
- T132 (= T399) binding
- K161 (= K428) binding
2nsyA Crystal structure of nh3-dependent NAD+ synthetase from bacillus subtilis in complex with NAD-adenylate (see paper)
31% identity, 38% coverage: 277:487/554 of query aligns to 29:235/271 of 2nsyA
- active site: D50 (= D298), E162 (= E404)
- binding adenosine monophosphate: G44 (= G292), I45 (≠ L293), S46 (= S294), S51 (= S299), R78 (≠ P321), L79 (≠ S322), Q84 (= Q327), R139 (= R381), T157 (= T399), D173 (= D415), T208 (= T464), A209 (= A465)
- binding magnesium ion: D50 (= D298), E162 (= E404)
- binding nicotinamide-adenine-dinucleotide: Y32 (= Y280), F129 (≠ A371), N133 (= N375), Y144 (≠ M386), L153 (≠ M395), F167 (≠ Y409), F168 (≠ A410), T169 (= T411), K170 (≠ L412), D173 (= D415), D177 (= D425), A209 (= A465), L211 (= L467), E223 (≠ T476)
- binding pyrophosphate 2-: S46 (= S294), G48 (= G296), D50 (= D298), S51 (= S299), K186 (≠ L434), P207 (= P463), T208 (= T464)
Sites not aligning to the query:
1kqpA Nh3-dependent NAD+ synthetase from bacillus subtilis at 1 a resolution (see paper)
31% identity, 38% coverage: 277:487/554 of query aligns to 29:235/271 of 1kqpA
- active site: D50 (= D298), E162 (= E404)
- binding nicotinamide-adenine-dinucleotide-adenylate intermediate: Y32 (= Y280), G44 (= G292), I45 (≠ L293), S46 (= S294), R78 (≠ P321), L79 (≠ S322), Q84 (= Q327), F129 (≠ A371), N133 (= N375), R139 (= R381), Y144 (≠ M386), L153 (≠ M395), T157 (= T399), E162 (= E404), F167 (≠ Y409), F168 (≠ A410), T169 (= T411), K170 (≠ L412), D173 (= D415), D177 (= D425), T208 (= T464), A209 (= A465), L211 (= L467), E223 (≠ T476)
- binding magnesium ion: D50 (= D298), E162 (= E404)
- binding pyrophosphate 2-: S46 (= S294), G48 (= G296), D50 (= D298), S51 (= S299), K186 (≠ L434), P207 (= P463), T208 (= T464)
Sites not aligning to the query:
1ih8A Nh3-dependent NAD+ synthetase from bacillus subtilis complexed with amp-cpp and mg2+ ions. (see paper)
31% identity, 38% coverage: 277:487/554 of query aligns to 29:235/271 of 1ih8A
- active site: D50 (= D298), E162 (= E404)
- binding diphosphomethylphosphonic acid adenosyl ester: G44 (= G292), I45 (≠ L293), S46 (= S294), G48 (= G296), Q49 (≠ I297), D50 (= D298), S51 (= S299), R78 (≠ P321), L79 (≠ S322), Q84 (= Q327), R139 (= R381), P207 (= P463), T208 (= T464)
1fydA Crystal structure of nh3-dependent NAD+ synthetase from bacillus subtilis complexed with one molecule amp, one pyrophosphate ion and one mg2+ ion (see paper)
31% identity, 38% coverage: 277:487/554 of query aligns to 29:235/271 of 1fydA
- active site: D50 (= D298), E162 (= E404)
- binding adenosine monophosphate: G44 (= G292), I45 (≠ L293), S46 (= S294), S51 (= S299), R78 (≠ P321), L79 (≠ S322), Q84 (= Q327), T157 (= T399)
- binding pyrophosphate 2-: S46 (= S294), G48 (= G296), Q49 (≠ I297), D50 (= D298), S51 (= S299), K186 (≠ L434), P207 (= P463), T208 (= T464)
Query Sequence
>AZOBR_RS04215 FitnessBrowser__azobra:AZOBR_RS04215
MTDRLSIALAQINPTVGAITTNIDRIRDARAEAAARGADLMVCPELAVTGYPPEDLVLKP
FFLDVVEQAVRELAAETADGGPALLVGAPWRDGDKRHNAALLLDGGRIAATRFKVDLPNY
GVFDEKRVFTPGPLPGPINVRGVRLGVPICEDMWSADVIETLAESGAEILVVPNGSPFEL
GKHDQRVQLAVGRVTESSLPLLYVNQVGGQDELVFDGASFALGADCRLVAQAPAFTEHLL
ITRWERGEDDVWSCADTECVAPPEGLESIYAALVLALRDYVTKNRFPGVILGLSGGIDSA
LAAAIAVDALGAERVHGVMMPSPHTAQDSLDDAAESAELLGCKLDTVPIVPAMEAFERML
LPAFAGRDPDATEENIQARSRGVTLMALSNKFGPMVLSTGNKSEMSVGYATLYGDMCGGY
AVLKDVYKTTVYALARWRNAHQTEGAFGPAGRVVPERVLVKAPTAELKPDQTDQDTLPPY
DALDDILRCLVEKDLGVAEIVARGHAPEVVDRVWRMLHLAEYKRRQAPPGPKITPRLFNR
ERRYPITNGFGSIA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory