SitesBLAST
Comparing AZOBR_RS04235 FitnessBrowser__azobra:AZOBR_RS04235 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
40% identity, 95% coverage: 1:431/452 of query aligns to 1:457/485 of Q8DLI5
- R6 (= R6) binding
- Y192 (= Y184) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
40% identity, 95% coverage: 2:431/452 of query aligns to 1:456/484 of 2cfoA
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
35% identity, 99% coverage: 1:447/452 of query aligns to 1:457/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
40% identity, 73% coverage: 1:332/452 of query aligns to 1:323/471 of P04805
- C98 (= C97) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ E99) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ A130) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ R132) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ R134) mutation to Q: No change in activity or in zinc content.
- H131 (≠ E136) mutation to Q: No change in activity or in zinc content.
- H132 (≠ S137) mutation to Q: No change in activity or in zinc content.
- C138 (≠ H143) mutation to S: No change in activity or in zinc content.
- S239 (= S247) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
39% identity, 74% coverage: 3:338/452 of query aligns to 3:318/380 of 4g6zA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
32% identity, 98% coverage: 3:447/452 of query aligns to 103:555/564 of 3al0C
- active site: S110 (= S10), K335 (= K248)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R6), A108 (= A8), P109 (= P9), G118 (= G18), T122 (≠ L22), E142 (≠ D42), Y276 (= Y184), R294 (= R202), G295 (= G203), D297 (= D205), H298 (= H206), L324 (= L237), I325 (≠ L238), L333 (= L246)
- binding : T144 (= T44), D145 (= D45), R148 (= R48), Y208 (≠ P101), P213 (≠ L106), K252 (≠ R160), M255 (≠ V163), I266 (≠ V174), K269 (≠ R177), S270 (≠ E178), Y276 (= Y184), D297 (= D205), H298 (= H206), L299 (≠ V207), S300 (≠ A208), N301 (= N209), K304 (≠ V212), R330 (≠ G243), P332 (≠ G245), G363 (= G277), W364 (≠ T278), R365 (≠ S279), E370 (≠ P284), S387 (= S301), K389 (≠ A303), V391 (≠ P305), I392 (≠ K306), K397 (≠ E311), W400 (≠ R314), R407 (≠ H321), E446 (≠ S353), K447 (≠ R354), Q453 (≠ D360), I457 (≠ V364), R509 (= R409), K520 (= K412), Q524 (≠ L416), R527 (= R419), V535 (≠ H427), T536 (≠ G428), G538 (≠ E430), L539 (= L431)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
31% identity, 99% coverage: 2:447/452 of query aligns to 2:494/502 of 6brlA
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
33% identity, 73% coverage: 2:333/452 of query aligns to 1:348/485 of 4griB
- active site: S9 (= S10), K253 (= K248)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (≠ D42), Y194 (= Y184), R212 (= R202), W216 (≠ H206)
- binding zinc ion: C105 (= C97), C107 (≠ E99), Y128 (= Y120), C132 (≠ A124)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
34% identity, 75% coverage: 2:338/452 of query aligns to 3:339/488 of 8vc5A
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
33% identity, 98% coverage: 3:447/452 of query aligns to 2:463/468 of 2cv2A
- active site: K246 (= K248)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R6), A7 (= A8), S9 (= S10), G17 (= G18), I21 (≠ L22), E41 (≠ D42), Y187 (= Y184), R205 (= R202), A206 (≠ G203), E208 (≠ D205), W209 (≠ H206), L235 (= L237), L236 (= L238)
- binding : S9 (= S10), T43 (= T44), D44 (= D45), R47 (= R48), V145 (≠ R132), R163 (= R160), Y168 (≠ F165), E172 (≠ A169), V177 (= V174), K180 (≠ R177), S181 (≠ E178), Y187 (= Y184), E207 (= E204), E208 (≠ D205), W209 (≠ H206), V211 (≠ A208), R237 (≠ T239), K241 (≠ G243), L272 (≠ K275), M273 (≠ L276), G274 (= G277), E282 (= E283), S299 (= S301), P303 (= P305), V304 (≠ K306), K309 (≠ E311), W312 (≠ R314), R319 (≠ L320), P357 (= P350), R358 (vs. gap), R417 (vs. gap), Q432 (≠ L416), R435 (= R419), L442 (≠ D426), E443 (≠ H427), T444 (≠ G428), G446 (≠ E430), L447 (= L431), F448 (≠ K432)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
33% identity, 98% coverage: 3:447/452 of query aligns to 2:463/468 of 2cv1A
- active site: K246 (= K248)
- binding adenosine-5'-triphosphate: P8 (= P9), S9 (= S10), G17 (= G18), T18 (≠ N19), I21 (≠ L22), R47 (= R48), A206 (≠ G203), W209 (≠ H206), L235 (= L237), L236 (= L238)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R6), A7 (= A8), E41 (≠ D42), Y187 (= Y184), R205 (= R202), W209 (≠ H206)
- binding : S9 (= S10), E41 (≠ D42), T43 (= T44), D44 (= D45), R47 (= R48), V145 (≠ R132), R163 (= R160), V166 (= V163), E172 (≠ A169), V177 (= V174), K180 (≠ R177), S181 (≠ E178), Y187 (= Y184), E207 (= E204), E208 (≠ D205), W209 (≠ H206), V211 (≠ A208), R237 (≠ T239), K241 (≠ G243), K243 (≠ G245), M273 (≠ L276), G274 (= G277), S276 (= S279), E282 (= E283), S299 (= S301), P303 (= P305), V304 (≠ K306), K309 (≠ E311), W312 (≠ R314), R319 (≠ L320), P357 (= P350), R358 (vs. gap), R417 (vs. gap), L427 (≠ G411), Q432 (≠ L416), R435 (= R419), L442 (≠ D426), E443 (≠ H427), T444 (≠ G428), G446 (≠ E430), L447 (= L431), F448 (≠ K432)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
33% identity, 98% coverage: 3:447/452 of query aligns to 2:463/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
33% identity, 98% coverage: 3:447/452 of query aligns to 2:463/468 of 1n78A
- active site: K246 (= K248)
- binding glutamol-amp: R5 (= R6), A7 (= A8), P8 (= P9), S9 (= S10), G17 (= G18), T18 (≠ N19), I21 (≠ L22), E41 (≠ D42), Y187 (= Y184), N191 (≠ S188), R205 (= R202), A206 (≠ G203), E208 (≠ D205), W209 (≠ H206), L235 (= L237), L236 (= L238)
- binding : S9 (= S10), T43 (= T44), D44 (= D45), R47 (= R48), V145 (≠ R132), R163 (= R160), V166 (= V163), Y168 (≠ F165), E172 (≠ A169), V177 (= V174), K180 (≠ R177), S181 (≠ E178), Y187 (= Y184), E207 (= E204), E208 (≠ D205), W209 (≠ H206), L210 (≠ V207), V211 (≠ A208), R237 (≠ T239), K241 (≠ G243), M273 (≠ L276), G274 (= G277), E282 (= E283), R297 (≠ K299), P303 (= P305), V304 (≠ K306), K309 (≠ E311), W312 (≠ R314), R319 (≠ L320), P357 (= P350), R358 (vs. gap), R417 (vs. gap), L427 (≠ G411), Q432 (≠ L416), R435 (= R419), L442 (≠ D426), E443 (≠ H427), T444 (≠ G428), G446 (≠ E430), L447 (= L431), F448 (≠ K432)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
33% identity, 98% coverage: 3:447/452 of query aligns to 2:463/468 of 1j09A
- active site: K246 (= K248)
- binding adenosine-5'-triphosphate: H15 (= H16), E208 (≠ D205), L235 (= L237), L236 (= L238), K243 (≠ G245), I244 (≠ L246), S245 (= S247), K246 (= K248), R247 (= R249)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (≠ D42), Y187 (= Y184), N191 (≠ S188), R205 (= R202), W209 (≠ H206)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
33% identity, 98% coverage: 3:447/452 of query aligns to 2:463/468 of P27000
- R358 (vs. gap) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
33% identity, 98% coverage: 3:447/452 of query aligns to 2:463/468 of 1g59A
- binding : D44 (= D45), R45 (≠ E46), A46 (≠ E47), R47 (= R48), P109 (= P101), V145 (≠ R132), R163 (= R160), V166 (= V163), E172 (≠ A169), V177 (= V174), K180 (≠ R177), S181 (≠ E178), D182 (= D179), E207 (= E204), E208 (≠ D205), R237 (≠ T239), K241 (≠ G243), T242 (≠ Q244), K243 (≠ G245), M273 (≠ L276), G274 (= G277), E282 (= E283), S299 (= S301), L300 (≠ R302), P303 (= P305), V304 (≠ K306), K309 (≠ E311), W312 (≠ R314), R319 (≠ L320), P357 (= P350), R358 (vs. gap), R417 (vs. gap), K426 (= K410), L427 (≠ G411), Q432 (≠ L416), R435 (= R419), L442 (≠ D426), E443 (≠ H427), T444 (≠ G428), P445 (= P429), G446 (≠ E430), L447 (= L431), F448 (≠ K432)
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
35% identity, 55% coverage: 6:253/452 of query aligns to 7:234/290 of 4a91A
- active site: S11 (= S10), K229 (= K248)
- binding glutamic acid: R7 (= R6), A9 (= A8), S11 (= S10), E43 (≠ D42), Y170 (= Y184), R188 (= R202), L192 (≠ H206)
- binding zinc ion: C99 (= C97), C101 (≠ E99), Y113 (= Y120), C117 (≠ A124)
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
36% identity, 54% coverage: 6:249/452 of query aligns to 19:242/308 of P27305
- E55 (≠ D42) binding
- Y182 (= Y184) binding
- R200 (= R202) binding
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
30% identity, 62% coverage: 3:281/452 of query aligns to 11:282/455 of 3aiiA
P46655 Glutamate--tRNA ligase, cytoplasmic; Glutamyl-tRNA synthetase; (c)ERS; GluRS; P85; EC 6.1.1.17 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 44% coverage: 3:202/452 of query aligns to 202:400/708 of P46655
Sites not aligning to the query:
- 148 R→A: Abolishes interaction with ARC1.
Query Sequence
>AZOBR_RS04235 FitnessBrowser__azobra:AZOBR_RS04235
MSVAVRFAPSPTGLLHVGNVRLALVNWLFARKAGGNFLLRLDDTDEERSKPEYAEGIERD
LTWLGLTWDRFARESDRYGRYDEVAAALKASGRLYPCYETPEELNLKRASLVSQGRPPIY
DRAALRLGDADRARLESEGRKPHWRFKLEHTPVEWTDLVRGPVHFEGAALSDPVLIREDG
RPLYTLTSVVDDADLAITHVIRGEDHVANTAVQIQIFEALTNSEGGGVVPVFAHLPLLTD
ATGQGLSKRLGSLSVASLREEEGIEPMALASLLAKLGTSDAIEPRLTLDELVAEFDIAKV
SRATPKFDPEELLRLNARILHLLPFERVAGELAALGLDDADAAFWEAVRPNLSRVAEARD
WWAVTHAPVAPAADDPAFLAEAAALLPEEPWDLSTWGTWTGAVKAKTGRKGKDLFLPLRR
ALTGRDHGPELKNLLPLIGRTRAEKRLAGETA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory