Comparing AZOBR_RS04510 FitnessBrowser__azobra:AZOBR_RS04510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5gtwA The n253r mutant structures of trehalose synthase from deinococcus radiodurans display two different active-site conformations
44% identity, 96% coverage: 6:542/562 of query aligns to 3:546/548 of 5gtwA
5x7uA Trehalose synthase from thermobaculum terrenum (see paper)
44% identity, 86% coverage: 6:491/562 of query aligns to 4:488/546 of 5x7uA
Sites not aligning to the query:
5ykbD The n253f mutant structure of trehalose synthase from deinococcus radiodurans reveals an open active-site conformation (see paper)
44% identity, 96% coverage: 6:542/562 of query aligns to 3:522/523 of 5ykbD
3zo9A The structure of trehalose synthase (tres) of mycobacterium smegmatis (see paper)
43% identity, 88% coverage: 6:502/562 of query aligns to 7:506/549 of 3zo9A
3zoaA The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
43% identity, 88% coverage: 6:502/562 of query aligns to 6:505/548 of 3zoaA
Sites not aligning to the query:
A0R6E0 Trehalose synthase/amylase TreS; Maltose alpha-D-glucosyltransferase; MTase; EC 3.2.1.1; EC 5.4.99.16 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
43% identity, 88% coverage: 6:500/562 of query aligns to 35:541/593 of A0R6E0
5jy7B Complex of mycobacterium smegmatis trehalose synthase with maltokinase (see paper)
43% identity, 88% coverage: 6:502/562 of query aligns to 19:527/571 of 5jy7B
3zoaB The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
43% identity, 88% coverage: 6:502/562 of query aligns to 19:527/571 of 3zoaB
4lxfA Crystal structure of m. Tuberculosis tres (see paper)
41% identity, 96% coverage: 6:542/562 of query aligns to 32:568/570 of 4lxfA
4lxfB Crystal structure of m. Tuberculosis tres (see paper)
40% identity, 96% coverage: 6:542/562 of query aligns to 32:544/546 of 4lxfB
4aieA Structure of glucan-1,6-alpha-glucosidase from lactobacillus acidophilus ncfm (see paper)
32% identity, 94% coverage: 6:535/562 of query aligns to 3:529/537 of 4aieA
2ze0A Alpha-glucosidase gsj (see paper)
33% identity, 88% coverage: 3:495/562 of query aligns to 1:486/531 of 2ze0A
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
29% identity, 96% coverage: 6:543/562 of query aligns to 3:546/546 of 8ibkA
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
31% identity, 87% coverage: 6:494/562 of query aligns to 2:514/559 of 4mazA
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
31% identity, 87% coverage: 6:494/562 of query aligns to 4:516/561 of O06994
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
31% identity, 87% coverage: 6:493/562 of query aligns to 2:513/559 of 7lv6B
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
31% identity, 87% coverage: 6:494/562 of query aligns to 2:511/556 of 5wczA
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
31% identity, 87% coverage: 6:494/562 of query aligns to 2:511/555 of 4m56A
4wlcA Structure of dextran glucosidase with glucose (see paper)
30% identity, 90% coverage: 6:513/562 of query aligns to 5:522/536 of 4wlcA
2zidA Crystal structure of dextran glucosidase e236q complex with isomaltotriose (see paper)
30% identity, 90% coverage: 6:513/562 of query aligns to 5:522/536 of 2zidA
>AZOBR_RS04510 FitnessBrowser__azobra:AZOBR_RS04510
MIKDLWYKNAVIYNLSVGTFMDANGDGIGDFQGLQRRLDYLQGLGVTCLWLGPFQPSPMR
DHGYDVADYYNVDPRYGTLGDFVEFSHACKQRGIRVIIDLVVNHTSDQHPWFQAARKDPD
SPYRDWYVWSDKKPDDADQGVVFPGVQKTTWSWDKEARAYYFHRFYEFQPDLNTANPEVQ
AELLKVMGFWIELGVSGFRMDAVPFVIATKGPDVKKPKQQFDMLRTFREFVQWRCGDAVL
LAEANVLPTVDQEYFGDDGDRMQMVFNFQVNQNLFYALATADTRPLAKALDVTRVPRPST
NQWGLFLRNHDELDLGRLTEAQRKRVFDAFGPDKDMQLYDRGIRRRLAPMLRGDRRWLEL
AYSLLFTLPGTPVLRYGDEIGMGDDLSLPERECARTPMQWSDEPQGGFTKADDPVHPVIS
GGAYGYERINAAHQRRDPSALLNWTERIIRMRKECPEIGWGDFQVLPTGSNAVLAIRYDW
RNNSVLVVHNLDDRPHEIALAVDGTGESPRLVNLLAEDHNDPEEDGRHRLVLEPYGYRWY
RLGGLDYLLRRTEGPVGGAKRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory