Comparing AZOBR_RS04600 FitnessBrowser__azobra:AZOBR_RS04600 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
45% identity, 67% coverage: 86:300/319 of query aligns to 66:276/285 of 3uf6A
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
45% identity, 67% coverage: 86:300/319 of query aligns to 68:278/288 of 3u9eB
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
28% identity, 74% coverage: 55:291/319 of query aligns to 46:307/325 of 1xcoD
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 57% coverage: 132:312/319 of query aligns to 536:713/714 of Q8ZND6
Sites not aligning to the query:
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
29% identity, 69% coverage: 93:311/319 of query aligns to 108:331/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
29% identity, 69% coverage: 93:311/319 of query aligns to 107:330/332 of 2af3C
Sites not aligning to the query:
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
30% identity, 62% coverage: 96:294/319 of query aligns to 117:320/339 of 6ioxA
6zngF Maeb full-length acetyl-coa bound state (see paper)
27% identity, 71% coverage: 93:318/319 of query aligns to 532:751/753 of 6zngF
Sites not aligning to the query:
>AZOBR_RS04600 FitnessBrowser__azobra:AZOBR_RS04600
MAGSQPPPAHRHEKYERLVAACRAISPVSTAVAHPCDASSLGGAVDAARQGFIIPILIGP
AARIRAVADESGLDIVPYEIVDVPHSHAAAATAVEMVRQGRAQLLMKGSLHTDELLREVA
RKDSGLRTERRISHVFIMDVPTYAKPLFITDAAVNIAPTLEDKRDIIQNAIDLARALGNP
QPKVAILSAVETINPKIPSTVEAGALCKMADRGQITGGLLDGPLALDNAISPEAVRIKGI
ASPVAGQADILVVPDLEAGNMLAKNLTFLANADAAGIVLGARVPIVLTSRADSVMTRMAS
CAVAALYAHRQRIEQPVKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory