SitesBLAST
Comparing AZOBR_RS04605 FitnessBrowser__azobra:AZOBR_RS04605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
1tuuB Acetate kinase crystallized with atpgs (see paper)
39% identity, 98% coverage: 5:393/398 of query aligns to 3:397/398 of 1tuuB
- active site: N7 (= N9), R91 (= R95), H180 (= H183), R241 (= R243), E384 (= E380)
- binding adenosine monophosphate: D283 (= D284), R285 (= R286), G331 (= G329), I332 (= I330), N335 (≠ R333), S336 (≠ A334)
- binding trihydrogen thiodiphosphate: H180 (= H183), G212 (= G214), R241 (= R243)
P38502 Acetate kinase; Acetokinase; EC 2.7.2.1 from Methanosarcina thermophila (see 5 papers)
39% identity, 98% coverage: 5:393/398 of query aligns to 3:397/408 of P38502
- N7 (= N9) mutation to A: Almost abolishes catalytic activity. Requires increased magnesium levels for activity. Strongly decreases affinity for acetate.; mutation to D: Almost abolishes catalytic activity. Strongly decreases affinity for acetate.
- S10 (= S12) mutation S->A,T: Strongly decreases catalytic activity. Strongly decreases affinity for acetate.
- S12 (= S14) mutation to A: Decreases catalytic activity. Strongly decreases affinity for acetate. Requires increased magnesium levels for enzyme activity.; mutation to T: Decreases catalytic activity. Strongly decreases affinity for acetate.
- K14 (= K16) mutation to A: Strongly decreases enzyme activity.; mutation to R: Reduces enzyme activity.
- R91 (= R95) mutation R->A,L: Decreases catalytic activity. Decreases affinity for acetate.
- V93 (= V97) mutation to A: Decreases affinity for acetate.
- L122 (= L126) mutation to A: Decreases affinity for acetate.
- D148 (= D152) active site, Proton donor/acceptor; mutation D->A,E,N: Abolishes catalytic activity. Decreases affinity for acetate, but not for ATP.
- F179 (= F182) mutation to A: Decreases affinity for acetate.
- N211 (≠ S213) mutation to A: Slightly reduced enzyme activity.
- P232 (≠ A234) mutation to A: Decreases affinity for acetate.
- R241 (= R243) mutation R->K,L: Decreases catalytic activity. Strongly reduced affinity for ATP.
- E384 (= E380) mutation to A: Almost abolishes catalytic activity. Strongly decreases affinity for acetate. Requires strongly increased magnesium levels for enzyme activity.
1tuuA Acetate kinase crystallized with atpgs (see paper)
39% identity, 98% coverage: 5:393/398 of query aligns to 3:397/399 of 1tuuA
- active site: N7 (= N9), R91 (= R95), H180 (= H183), R241 (= R243), E384 (= E380)
- binding adenosine-5'-diphosphate: K14 (= K16), G210 (= G212), D283 (= D284), F284 (≠ V285), R285 (= R286), G331 (= G329), I332 (= I330), N335 (≠ R333)
- binding sulfate ion: R91 (= R95), H180 (= H183), G212 (= G214)
7fj9A Kpacka (pduw) with amppnp complex structure
42% identity, 96% coverage: 2:385/398 of query aligns to 1:385/395 of 7fj9A
7fj8A Kpacka (pduw) with amp complex structure
42% identity, 96% coverage: 2:385/398 of query aligns to 1:385/395 of 7fj8A
4fwsA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with ctp (see paper)
38% identity, 96% coverage: 4:386/398 of query aligns to 3:384/394 of 4fwsA
- active site: N8 (= N9), R83 (= R95), H172 (= H183), R233 (= R243), E378 (= E380)
- binding cytidine-5'-triphosphate: G202 (= G212), N203 (≠ S213), G204 (= G214), D275 (= D284), L276 (≠ V285), R277 (= R286), G323 (= G329), I324 (= I330), N327 (≠ R333)
- binding 1,2-ethanediol: V21 (≠ A22), C24 (≠ L27), H115 (= H127), N203 (≠ S213), T232 (= T242), R233 (= R243), K262 (≠ H271)
4fwrA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with cmp (see paper)
38% identity, 96% coverage: 4:386/398 of query aligns to 3:384/394 of 4fwrA
- active site: N8 (= N9), R83 (= R95), H172 (= H183), R233 (= R243), E378 (= E380)
- binding cytidine-5'-monophosphate: G202 (= G212), N203 (≠ S213), D275 (= D284), L276 (≠ V285), R277 (= R286), G323 (= G329), I324 (= I330), N327 (≠ R333)
4fwqA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gtp (see paper)
38% identity, 96% coverage: 4:386/398 of query aligns to 3:384/394 of 4fwqA
- active site: N8 (= N9), R83 (= R95), H172 (= H183), R233 (= R243), E378 (= E380)
- binding guanosine-5'-triphosphate: H172 (= H183), N203 (≠ S213), G204 (= G214), D275 (= D284), L276 (≠ V285), R277 (= R286), E280 (≠ L289), G323 (= G329), I324 (= I330), N327 (≠ R333)
4fwpA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gdp (see paper)
38% identity, 96% coverage: 4:386/398 of query aligns to 3:384/394 of 4fwpA
- active site: N8 (= N9), R83 (= R95), H172 (= H183), R233 (= R243), E378 (= E380)
- binding 1,2-ethanediol: S11 (= S12), H115 (= H127), K262 (≠ H271)
- binding guanosine-5'-diphosphate: N203 (≠ S213), D275 (= D284), L276 (≠ V285), R277 (= R286), E280 (≠ L289), G323 (= G329), I324 (= I330), N327 (≠ R333), S328 (≠ A334)
4fwoA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gmp (see paper)
38% identity, 96% coverage: 4:386/398 of query aligns to 3:384/394 of 4fwoA
- active site: N8 (= N9), R83 (= R95), H172 (= H183), R233 (= R243), E378 (= E380)
- binding guanosine-5'-monophosphate: G202 (= G212), N203 (≠ S213), D275 (= D284), L276 (≠ V285), R277 (= R286), E280 (≠ L289), G323 (= G329), I324 (= I330), N327 (≠ R333)
- binding 1,2-ethanediol: E100 (≠ A112), N104 (≠ T116)
4fwnA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with adenosine tetraphosphate (ap4) (see paper)
38% identity, 96% coverage: 4:386/398 of query aligns to 3:384/394 of 4fwnA
- active site: N8 (= N9), R83 (= R95), H172 (= H183), R233 (= R243), E378 (= E380)
- binding adenosine-5'-tetraphosphate: H172 (= H183), H200 (= H210), N203 (≠ S213), G204 (= G214), D275 (= D284), L276 (≠ V285), R277 (= R286), G323 (= G329), I324 (= I330), N327 (≠ R333)
4fwmA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with atp (see paper)
38% identity, 96% coverage: 4:386/398 of query aligns to 3:384/394 of 4fwmA
- active site: N8 (= N9), R83 (= R95), H172 (= H183), R233 (= R243), E378 (= E380)
- binding adenosine-5'-triphosphate: H172 (= H183), H200 (= H210), N203 (≠ S213), G204 (= G214), D275 (= D284), L276 (≠ V285), R277 (= R286), G323 (= G329), I324 (= I330), N327 (≠ R333)
- binding 1,2-ethanediol: H172 (= H183), R233 (= R243)
4fwkA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with amp (see paper)
38% identity, 96% coverage: 4:386/398 of query aligns to 3:384/394 of 4fwkA
- active site: N8 (= N9), R83 (= R95), H172 (= H183), R233 (= R243), E378 (= E380)
- binding adenosine monophosphate: G202 (= G212), N203 (≠ S213), D275 (= D284), L276 (≠ V285), R277 (= R286), G323 (= G329), I324 (= I330), N327 (≠ R333)
- binding 1,2-ethanediol: D103 (≠ G115), N104 (≠ T116), R107 (≠ T119)
2e1zA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with diadenosine tetraphosphate (ap4a) obtained after co- crystallization with atp (see paper)
38% identity, 96% coverage: 4:386/398 of query aligns to 3:384/394 of 2e1zA
- active site: N8 (= N9), R83 (= R95), H172 (= H183), R233 (= R243), E378 (= E380)
- binding bis(adenosine)-5'-tetraphosphate: N8 (= N9), R83 (= R95), H115 (= H127), G202 (= G212), N203 (≠ S213), G204 (= G214), P224 (≠ A234), R233 (= R243), D275 (= D284), L276 (≠ V285), R277 (= R286), G323 (= G329), I324 (= I330), N327 (≠ R333)
1x3nA Crystal structure of amppnp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
38% identity, 96% coverage: 4:386/398 of query aligns to 3:384/394 of 1x3nA
- active site: N8 (= N9), R83 (= R95), H172 (= H183), R233 (= R243), E378 (= E380)
- binding phosphoaminophosphonic acid-adenylate ester: G202 (= G212), N203 (≠ S213), G204 (= G214), D275 (= D284), L276 (≠ V285), R277 (= R286), G323 (= G329), I324 (= I330), N327 (≠ R333)
1x3mA Crystal structure of adp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
38% identity, 96% coverage: 4:386/398 of query aligns to 3:384/394 of 1x3mA
- active site: N8 (= N9), R83 (= R95), H172 (= H183), R233 (= R243), E378 (= E380)
- binding adenosine-5'-diphosphate: G202 (= G212), N203 (≠ S213), D275 (= D284), L276 (≠ V285), R277 (= R286), G322 (≠ A328), G323 (= G329), I324 (= I330), N327 (≠ R333)
4ijnA Crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate (see paper)
38% identity, 96% coverage: 4:385/398 of query aligns to 3:370/376 of 4ijnA
- active site: N8 (= N9), R72 (= R95), H161 (= H183), R222 (= R243), E365 (= E380)
- binding adenosine monophosphate: G191 (= G212), N192 (≠ S213), D263 (≠ N283), F264 (vs. gap), R265 (vs. gap), G311 (= G329), V312 (≠ I330), N315 (≠ R333), V316 (≠ A334)
4iz9A Crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese (see paper)
41% identity, 96% coverage: 5:385/398 of query aligns to 6:372/381 of 4iz9A
- active site: N10 (= N9), R74 (= R95), H163 (= H183), R224 (= R243), E367 (= E380)
- binding diphosphomethylphosphonic acid adenosyl ester: K17 (= K16), G193 (= G212), N194 (≠ S213), D265 (≠ N283), F266 (vs. gap), R267 (vs. gap), G313 (= G329), I314 (= I330), N317 (≠ R333), D318 (≠ A334)
Query Sequence
>AZOBR_RS04605 FitnessBrowser__azobra:AZOBR_RS04605
MTETILVINAGSSSIKFQLFDAADGTLPVRLRGRIEGIGTAPRLIVQESGQDGSRDGGVT
LPAESGDGVPGALAFLGAWLRGRLGGAMPVAVGHRVVHGGPAYDSHVAVDDAVIGTLETY
VPLAPLHQPNNLAPIRAIRKLLPDVLQVACFDTAFHRHHSEPADRYAIPDALHREGVRRY
GFHGLSYEYIAGRLPDLAPGIAGGRVVVAHLGSGASMCAIQDGRSVDSTMGFTALDGLPM
GTRPGQLDPGVVLYLMDKGMDARAIERLLYHDCGLKGLSGISNDVRDLLASTDPRAKLAL
DCFVYRASLAIGALAAAMGGIDGLVFTAGIGERAPAIRKAIAERARWLGVDLDEAGNAAN
ALCITTPDSRVKGWVIPTDEERMIALHTRAILRRHRSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory