SitesBLAST
Comparing AZOBR_RS04795 FitnessBrowser__azobra:AZOBR_RS04795 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P35486 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Mus musculus (Mouse) (see 2 papers)
39% identity, 97% coverage: 8:324/327 of query aligns to 56:369/390 of P35486
- S232 (≠ A186) modified: Phosphoserine; by PDK1
- S293 (≠ F249) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4
- S300 (≠ T255) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4
- K336 (≠ E291) modified: N6-acetyllysine; mutation K->Q,R: Decreases phosphorylation at S-232 and S-300 but does not affect activity or substrate metabolism.
P29803 Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial; PDHE1-A type II; EC 1.2.4.1 from Homo sapiens (Human) (see 4 papers)
38% identity, 97% coverage: 8:324/327 of query aligns to 54:367/388 of P29803
- M227 (≠ E183) to V: in SPGF70; uncertain significance; dbSNP:rs200969445
- S230 (≠ A186) mutation to A: Slightly reduces enzyme activity.
- S291 (≠ F249) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4; mutation to A: Strongly reduces enzyme activity. Increases enzyme activity in stem cells.; mutation S->E,D: Abolishes enzyme activity. Increases neuronal cell death in response to glutamate excitotoxicity.
- S293 (≠ G251) modified: Phosphoserine; mutation to A: Increases enzyme activity in stem cells.; mutation to D: Abolishes enzyme activity. Increases neuronal cell death in response to glutamate excitotoxicity.
- S298 (≠ T255) modified: Phosphoserine; by PDK3; mutation to A: Slightly reduces enzyme activity.
P26284 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Rattus norvegicus (Rat) (see paper)
39% identity, 97% coverage: 8:324/327 of query aligns to 56:369/390 of P26284
- S232 (≠ A186) modified: Phosphoserine; by PDK1
- S293 (≠ F249) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4
- S300 (≠ T255) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4
P16387 Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial; Pyruvate dehydrogenase complex component E1 alpha; PDHE1-A; EC 1.2.4.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
39% identity, 98% coverage: 6:325/327 of query aligns to 74:392/420 of P16387
- S313 (≠ F249) modified: Phosphoserine; by PDK1 and PDK2
Sites not aligning to the query:
- 1:33 modified: transit peptide, Mitochondrion
P08559 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Homo sapiens (Human) (see 13 papers)
39% identity, 97% coverage: 8:324/327 of query aligns to 56:369/390 of P08559
- A136 (= A88) to T: found in a patient with moderate developmental delay, mild dysmorphism and mildly elevated serum lactate; uncertain significance; dbSNP:rs138727886
- S232 (≠ A186) modified: Phosphoserine; by PDK1; mutation to A: Abolishes inactivation by phosphorylation; when associated with A-293 and A-300.
- M282 (≠ L238) to L: in dbSNP:rs2229137
- S293 (≠ F249) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4; mutation to A: Reduces enzyme activity. Abolishes inactivation by phosphorylation; when associated with A-232 and A-300.; mutation to E: Interferes with substrate binding.
- S300 (≠ T255) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4; mutation to A: Abolishes inactivation by phosphorylation; when associated with A-232 and A-293.
- R302 (= R257) to C: in PDHAD; loss of activity; common mutation; dbSNP:rs137853252
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
- 10 R → P: in PDHAD; affects mitochondrial import of precursor protein; dbSNP:rs137853257
6cfoA Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
39% identity, 97% coverage: 8:324/327 of query aligns to 28:341/362 of 6cfoA
- active site: Q52 (≠ I32), G137 (= G119), R260 (= R244), H264 (= H248), S265 (≠ F249), Y273 (= Y256)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1S)-1-hydroxy-1-[(R)-hydroxy(oxo)-lambda~5~-phosphanyl]ethyl}-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: F62 (= F42), Y90 (≠ H70), R91 (= R71), G137 (= G119), V139 (≠ L121), G167 (= G149), D168 (= D150), G169 (= G151), N197 (= N179), Y199 (= Y181), G200 (≠ A182), H264 (= H248)
- binding magnesium ion: D168 (= D150), N197 (= N179), Y199 (= Y181)
1ni4A Human pyruvate dehydrogenase (see paper)
39% identity, 97% coverage: 8:324/327 of query aligns to 28:341/362 of 1ni4A
- active site: Q52 (≠ I32), G137 (= G119), R260 (= R244), H264 (= H248), S265 (≠ F249), Y273 (= Y256)
- binding magnesium ion: D168 (= D150), N197 (= N179), Y199 (= Y181)
- binding thiamine diphosphate: Y90 (≠ H70), R91 (= R71), V139 (≠ L121), G167 (= G149), D168 (= D150), G169 (= G151), A170 (= A152), N197 (= N179), G200 (≠ A182), H264 (= H248)
3exeA Crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex (see paper)
39% identity, 97% coverage: 8:324/327 of query aligns to 29:342/363 of 3exeA
- active site: Q53 (≠ I32), G138 (= G119), R261 (= R244), H265 (= H248), S266 (≠ F249), Y274 (= Y256)
- binding manganese (ii) ion: D169 (= D150), N198 (= N179), Y200 (= Y181)
- binding thiamine diphosphate: Y91 (≠ H70), R92 (= R71), V140 (≠ L121), G168 (= G149), D169 (= D150), G170 (= G151), A171 (= A152), N198 (= N179), Y200 (= Y181), G201 (≠ A182), H265 (= H248)
P26267 Pyruvate dehydrogenase E1 component subunit alpha type I, mitochondrial; PDHA1; PDHE1-A; EC 1.2.4.1 from Ascaris suum (Pig roundworm) (Ascaris lumbricoides) (see paper)
38% identity, 97% coverage: 8:324/327 of query aligns to 52:365/396 of P26267
- S289 (≠ F249) modified: Phosphoserine
- S296 (vs. gap) modified: Phosphoserine
Q10489 Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial; PDHE1-A; EC 1.2.4.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 98% coverage: 8:326/327 of query aligns to 73:390/409 of Q10489
- Y306 (≠ F245) modified: Phosphotyrosine
- S310 (≠ F249) modified: Phosphoserine
- S312 (≠ G251) modified: Phosphoserine
Sites not aligning to the query:
- 6 modified: Phosphothreonine
Q8H1Y0 Pyruvate dehydrogenase E1 component subunit alpha-2, mitochondrial; PDHE1-A; Protein IAA-CONJUGATE-RESISTANT 4; EC 1.2.4.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 96% coverage: 12:325/327 of query aligns to 62:373/393 of Q8H1Y0
- R121 (= R71) mutation to C: In iar4-1; reduced sensitivity to several IAA-amino acid conjugates.
6cerE Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
38% identity, 97% coverage: 8:324/327 of query aligns to 28:319/340 of 6cerE
6cerA Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
38% identity, 97% coverage: 8:324/327 of query aligns to 29:321/342 of 6cerA
3exhE Crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex (see paper)
37% identity, 97% coverage: 8:324/327 of query aligns to 28:310/331 of 3exhE
1umdA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
29% identity, 98% coverage: 5:324/327 of query aligns to 25:344/362 of 1umdA
- active site: I52 (= I32), S139 (≠ G119), R264 (= R244), H268 (= H248), S269 (≠ F249), Y277 (= Y256)
- binding 2-oxo-4-methylpentanoic acid: F61 (= F42), Y90 (≠ H70), S139 (≠ G119)
- binding magnesium ion: D170 (= D150), N199 (= N179), Y201 (= Y181)
- binding thiamine diphosphate: Y89 (≠ T69), Y90 (≠ H70), R91 (= R71), P140 (≠ I120), I141 (≠ L121), G169 (= G149), D170 (= D150), G171 (= G151), N199 (= N179), Y201 (= Y181), A202 (= A182), I203 (≠ E183), H268 (= H248)
1umcA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
29% identity, 98% coverage: 5:324/327 of query aligns to 25:344/362 of 1umcA
- active site: I52 (= I32), S139 (≠ G119), R264 (= R244), H268 (= H248), S269 (≠ F249), Y277 (= Y256)
- binding 4-methyl valeric acid: Y90 (≠ H70), H126 (= H106)
- binding magnesium ion: D170 (= D150), N199 (= N179), Y201 (= Y181)
- binding thiamine diphosphate: Y89 (≠ T69), Y90 (≠ H70), R91 (= R71), I141 (≠ L121), G169 (= G149), D170 (= D150), G171 (= G151), N199 (= N179), Y201 (= Y181), I203 (≠ E183), H268 (= H248)
1umbA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
29% identity, 98% coverage: 5:324/327 of query aligns to 25:344/362 of 1umbA
- active site: I52 (= I32), S139 (≠ G119), R264 (= R244), H268 (= H248), S269 (≠ F249), Y277 (= Y256)
- binding magnesium ion: D170 (= D150), N199 (= N179), Y201 (= Y181)
- binding thiamine diphosphate: Y89 (≠ T69), Y90 (≠ H70), R91 (= R71), P140 (≠ I120), I141 (≠ L121), G169 (= G149), D170 (= D150), G171 (= G151), N199 (= N179), Y201 (= Y181), A202 (= A182), I203 (≠ E183), H268 (= H248)
Q5SLR4 2-oxoisovalerate dehydrogenase subunit alpha; Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; BCKDH E1-alpha; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
29% identity, 98% coverage: 5:324/327 of query aligns to 30:349/367 of Q5SLR4
3dufA Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
29% identity, 97% coverage: 8:324/327 of query aligns to 38:345/365 of 3dufA
- active site: S62 (≠ D33), I139 (≠ G119), R264 (= R244), H268 (= H248), T269 (vs. gap), Y278 (= Y256)
- binding magnesium ion: D170 (= D150), N199 (= N179), F201 (≠ Y181)
- binding 2-{4-[(4-amino-2-methylpyrimidin-5-yl)methyl]-5-[(1r)-1-hydroxyethyl]-3-methyl-2-thienyl}ethyl trihydrogen diphosphate: Y99 (≠ H70), R100 (= R71), I141 (≠ L121), G169 (= G149), D170 (= D150), G171 (= G151), N199 (= N179), F201 (≠ Y181), A202 (= A182), H268 (= H248)
1w85A The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
28% identity, 97% coverage: 8:324/327 of query aligns to 38:339/358 of 1w85A
- active site: S62 (≠ D33), I139 (≠ G119), R264 (= R244), H268 (= H248), T269 (vs. gap)
- binding magnesium ion: D170 (= D150), N199 (= N179), F201 (≠ Y181)
- binding thiamine diphosphate: Y99 (≠ H70), R100 (= R71), I139 (≠ G119), I141 (≠ L121), G169 (= G149), D170 (= D150), G171 (= G151), G172 (≠ A152), N199 (= N179), A202 (= A182), I203 (≠ E183), H268 (= H248)
Query Sequence
>AZOBR_RS04795 FitnessBrowser__azobra:AZOBR_RS04795
VTNNPYPLDKADLLQAYRTMRTIREFEERLHIDFAKGDIPGFVHLYAGEEACATGIMMHL
NDNDRIASTHRGHGHCIAKGVDVHEMMAEIYGRSTGACRGKGGSMHIADLSKGMMGANGI
LGAGAPLICGAALAAKFRGDGGVGITFVGDGASNQGTFLESMNLAAVWNLPVVFVVENNG
YAESTAMEWAVSCDSYIDRATGFGLPGVTVDGTDFFAVHEAAGEIIRRAREGGGPALLEC
NMVRFYGHFEGDAQTYRAKGEVETLRANRDCIKLLAQRLTETGTVAPAELEAIDREVNAL
IEDAVRCAKAAPLPVAADLLKDVYVAY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory