Comparing AZOBR_RS04805 FitnessBrowser__azobra:AZOBR_RS04805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8R2Y0 Monoacylglycerol lipase ABHD6; 2-arachidonoylglycerol hydrolase; Abhydrolase domain-containing protein 6; EC 3.1.1.23 from Mus musculus (Mouse) (see paper)
26% identity, 68% coverage: 116:371/377 of query aligns to 51:322/336 of Q8R2Y0
6i8wB Crystal structure of a membrane phospholipase a, a novel bacterial virulence factor (see paper)
34% identity, 52% coverage: 138:333/377 of query aligns to 64:261/310 of 6i8wB
Sites not aligning to the query:
Q9BV23 Monoacylglycerol lipase ABHD6; 2-arachidonoylglycerol hydrolase; Abhydrolase domain-containing protein 6; EC 3.1.1.23 from Homo sapiens (Human) (see 2 papers)
25% identity, 68% coverage: 116:371/377 of query aligns to 51:322/337 of Q9BV23
P47229 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; 2,6-dioxo-6-phenylhexa-3-enoate hydrolase; EC 3.7.1.8 from Paraburkholderia xenovorans (strain LB400) (see paper)
28% identity, 66% coverage: 126:373/377 of query aligns to 24:283/286 of P47229
2og1A Crystal structure of bphd, a c-c hydrolase from burkholderia xenovorans lb400 (see paper)
28% identity, 66% coverage: 126:373/377 of query aligns to 23:282/285 of 2og1A
1iunB Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal (see paper)
29% identity, 67% coverage: 123:375/377 of query aligns to 11:271/276 of 1iunB
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
29% identity, 67% coverage: 123:375/377 of query aligns to 10:270/271 of 2d0dA
1ukaA Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate (see paper)
29% identity, 67% coverage: 123:375/377 of query aligns to 10:270/271 of 1ukaA
1uk9A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate (see paper)
29% identity, 67% coverage: 123:375/377 of query aligns to 10:270/271 of 1uk9A
1uk8A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate (see paper)
29% identity, 67% coverage: 123:375/377 of query aligns to 10:270/271 of 1uk8A
1uk7A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-butyrate (see paper)
29% identity, 67% coverage: 123:375/377 of query aligns to 10:270/271 of 1uk7A
1iupA Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates (see paper)
29% identity, 67% coverage: 123:375/377 of query aligns to 10:270/271 of 1iupA
2rhwA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3,10-di-fluoro hopda (see paper)
28% identity, 66% coverage: 126:373/377 of query aligns to 21:280/283 of 2rhwA
2rhtA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3-cl hopda (see paper)
28% identity, 66% coverage: 126:373/377 of query aligns to 21:280/283 of 2rhtA
2puhA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with its substrate hopda (see paper)
28% identity, 66% coverage: 126:373/377 of query aligns to 21:280/283 of 2puhA
P9WNH5 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase; 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; Meta-cleavage product hydrolase; MCP hydrolase; EC 3.7.1.17; EC 3.7.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 64% coverage: 127:368/377 of query aligns to 26:282/291 of P9WNH5
5jzbA Crystal structure of hsad bound to 3,5-dichlorobenzene sulphonamide (see paper)
28% identity, 64% coverage: 127:368/377 of query aligns to 20:276/282 of 5jzbA
7zm4A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc31 (see paper)
28% identity, 64% coverage: 127:368/377 of query aligns to 20:276/284 of 7zm4A
7zm3A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc17 (see paper)
28% identity, 64% coverage: 127:368/377 of query aligns to 20:276/284 of 7zm3A
7zm2A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclophostin-like inhibitor cyc8b (see paper)
28% identity, 64% coverage: 127:368/377 of query aligns to 20:276/284 of 7zm2A
>AZOBR_RS04805 FitnessBrowser__azobra:AZOBR_RS04805
MTTLNERIKPIVMPKWGLSMSEGKVTGWLKQPGATVNLGDDLLEVETDKITNVVEAGETG
VLRRVLGEPGTVYPVKALIAVLAEPDVPDSDIDAFIAGYAVPAADGEEDGADAGPRYEFA
ETAAGTIRYAKRGDGATTVLLVHGFGGDLDNWLFTIDALAEGATVYALDLPGHGQSAKTL
PDPTLTGLSKAVRDFMDAVGIEAAHLVGHSMGGAVSMRTALDAPERVVSLSLICSAGLGR
EINQDYIAGFIDATSRRDLKPVLETLFADAGLVSRQMTDDLLKYKRLDGVDGALRAIASS
MFENGEQTALLGEAVGAAKVPTLVVWGAEDRVIPAAHATALGSAARVEVVPKAGHMVQME
AAGTVNTLLKDHVTKNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory