SitesBLAST
Comparing AZOBR_RS04810 FitnessBrowser__azobra:AZOBR_RS04810 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wyeA Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with NAD+
49% identity, 97% coverage: 7:260/261 of query aligns to 2:254/255 of 3wyeA
- active site: G12 (= G17), S138 (= S143), Y151 (= Y156), K155 (= K160), L196 (≠ F201)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), Q11 (≠ R16), G12 (= G17), I13 (= I18), D32 (= D37), Y33 (≠ R38), V57 (= V62), D58 (= D63), V59 (= V64), N85 (= N90), A86 (= A91), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187), V184 (= V189), T186 (= T191), M188 (= M193), W189 (= W194)
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
48% identity, 97% coverage: 7:260/261 of query aligns to 3:255/256 of 1gegE
- active site: G13 (= G17), S139 (= S143), Y152 (= Y156), K156 (= K160), V197 (≠ F201)
- binding alpha-D-glucopyranose: R63 (= R67), D64 (≠ A68), F67 (≠ R71), E123 (≠ K127)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), Q12 (≠ R16), I14 (= I18), D33 (= D37), Y34 (≠ R38), V58 (= V62), D59 (= D63), V60 (= V64), N86 (= N90), A87 (= A91), I109 (≠ V113), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), V185 (= V189), T187 (= T191), M189 (= M193)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
47% identity, 97% coverage: 7:260/261 of query aligns to 3:255/256 of Q48436
- 6:33 (vs. 10:37, 54% identical) binding
- D59 (= D63) binding
- K156 (= K160) binding
Q9ZNN8 L-2,3-butanediol dehydrogenase; L-BDH; (S,S)-butanediol dehydrogenase; Diacetyl reductase [(S)-acetoin forming]; EC 1.1.1.76; EC 1.1.1.304 from Corynebacterium glutamicum (Brevibacterium saccharolyticum) (see paper)
44% identity, 97% coverage: 7:260/261 of query aligns to 3:257/258 of Q9ZNN8
- QGI 12:14 (≠ RGI 16:18) binding
- D33 (= D37) binding
- Q37 (≠ T39) binding
- DV 61:62 (= DV 63:64) binding
- N88 (= N90) binding
- I142 (= I144) mutation to Q: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with N-148.; mutation to Q: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- F148 (≠ Y150) mutation to N: Loss of L-BD oxidizing activity, and does not gain the ability to use meso-BD as substrate; when associated with Q-142.; mutation to N: Loss of L-BD oxidizing activity. Does not gain the ability to use meso-BD as substrate.
- Y154 (= Y156) binding
- K158 (= K160) binding
- PGIVGT 184:189 (≠ PGVVAT 186:191) binding
3a28C Crystal structure of l-2,3-butanediol dehydrogenase (see paper)
44% identity, 97% coverage: 7:260/261 of query aligns to 2:256/257 of 3a28C
- active site: G12 (= G17), S140 (= S143), Y153 (= Y156), K157 (= K160), L198 (≠ F201)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), Q11 (≠ R16), I13 (= I18), D32 (= D37), L33 (vs. gap), Q36 (≠ T39), L59 (≠ V62), D60 (= D63), V61 (= V64), N87 (= N90), S140 (= S143), Y153 (= Y156), K157 (= K160), P183 (= P186), V186 (= V189), T188 (= T191), M190 (= M193), W191 (= W194)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
42% identity, 98% coverage: 3:258/261 of query aligns to 4:255/258 of 3ak4A
- active site: G18 (= G17), S141 (= S143), L151 (= L153), Y154 (= Y156), K158 (= K160), E199 (≠ D198)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ R16), G18 (= G17), I19 (= I18), D38 (= D37), L39 (≠ R38), V60 (= V62), D61 (= D63), V62 (= V64), N88 (= N90), A89 (= A91), G90 (= G92), T139 (= T141), S141 (= S143), Y154 (= Y156), K158 (= K160), G185 (= G187), V187 (= V189), T189 (= T191), M191 (= M193)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
39% identity, 98% coverage: 4:260/261 of query aligns to 3:250/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), Q15 (≠ R16), G16 (= G17), I17 (= I18), D36 (= D37), V63 (= V64), N89 (= N90), A91 (≠ G92), S94 (≠ Q95), I142 (≠ T141), S143 (≠ A142), S144 (= S143), Y157 (= Y156), K161 (= K160), P187 (= P186), H188 (≠ G187), I190 (≠ V189), I194 (≠ M193)
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
40% identity, 98% coverage: 1:257/261 of query aligns to 1:253/257 of 6pejA
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
41% identity, 99% coverage: 1:258/261 of query aligns to 6:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (≠ G15), K21 (≠ R16), G22 (= G17), I23 (= I18), A43 (≠ D37), S44 (≠ R38), S45 (≠ T39), G68 (≠ V62), D69 (= D63), V70 (= V64), N96 (= N90), S97 (≠ A91), G98 (= G92), Y100 (≠ A94), I144 (≠ T141), S146 (= S143), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), M191 (≠ V188), I192 (≠ V189), T194 (= T191), G196 (= G200), T197 (≠ F201)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S143), Y159 (= Y156), M191 (≠ V188), I202 (≠ L206)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 100% coverage: 1:260/261 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G17), N111 (= N114), S139 (= S143), Q149 (≠ L153), Y152 (= Y156), K156 (= K160)
- binding acetoacetyl-coenzyme a: D93 (≠ T96), K98 (≠ D101), S139 (= S143), N146 (≠ Y150), V147 (≠ E151), Q149 (≠ L153), Y152 (= Y156), F184 (≠ V188), M189 (= M193), K200 (≠ H216)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ R16), G18 (= G17), I19 (= I18), D38 (= D37), F39 (≠ R38), V59 (= V62), D60 (= D63), V61 (= V64), N87 (= N90), A88 (= A91), G89 (= G92), I90 (≠ V93), T137 (= T141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), F184 (≠ V188), T185 (≠ V189), T187 (= T191), M189 (= M193)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
38% identity, 98% coverage: 2:258/261 of query aligns to 1:251/256 of 7do7A
- active site: G16 (= G17), S146 (= S143), Y159 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (= R16), G16 (= G17), I17 (= I18), S37 (vs. gap), D66 (= D63), A67 (≠ V64), N93 (= N90), A94 (= A91), G95 (= G92), I96 (≠ V93), V144 (≠ T141), S145 (≠ A142), S146 (= S143), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), I192 (≠ V189), T194 (= T191), I196 (≠ M193)
- binding beta-L-rhamnopyranose: F99 (≠ T96), S146 (= S143), S148 (≠ A145), Q156 (≠ L153), Y159 (= Y156), N197 (≠ W194), D235 (≠ S242), M236 (≠ D243), R238 (≠ D245)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
38% identity, 98% coverage: 2:258/261 of query aligns to 1:251/256 of 7b81A
- active site: G16 (= G17), S146 (= S143), Y159 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S14 (≠ G15), R15 (= R16), I17 (= I18), D66 (= D63), A67 (≠ V64), N93 (= N90), A94 (= A91), G95 (= G92), I96 (≠ V93), T116 (≠ V113), V144 (≠ T141), S146 (= S143), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), I192 (≠ V189), T194 (= T191), I196 (≠ M193)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
36% identity, 97% coverage: 7:258/261 of query aligns to 5:244/246 of 3osuA
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
37% identity, 97% coverage: 6:257/261 of query aligns to 5:240/251 of 6xewA
- active site: G16 (= G17), S138 (= S143), Y151 (= Y156)
- binding r,3-hydroxybutan-2-one: S138 (= S143), S140 (≠ A145), Y151 (= Y156)
- binding s,3-hydroxybutan-2-one: S138 (= S143), Y151 (= Y156), S182 (≠ G187)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), N15 (≠ R16), G16 (= G17), M17 (≠ I18), D36 (= D37), W37 (≠ R38), W37 (≠ R38), A38 (≠ T39), I59 (≠ V62), D60 (= D63), V61 (= V64), N87 (= N90), A88 (= A91), G89 (= G92), V110 (= V113), T136 (= T141), S138 (= S143), Y151 (= Y156), K155 (= K160), S182 (≠ G187), L183 (≠ V188), V184 (= V189), T186 (= T191), N187 (≠ E192), M188 (= M193), T189 (≠ W194)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
37% identity, 97% coverage: 6:257/261 of query aligns to 5:240/251 of H9XP47
- N15 (≠ R16) binding
- M17 (≠ I18) binding
- D36 (= D37) binding
- D60 (= D63) binding
- V61 (= V64) binding
- N87 (= N90) binding
- S138 (= S143) binding ; binding
- V139 (≠ I144) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ A145) binding
- Y151 (= Y156) binding ; binding ; binding
- K155 (= K160) binding
- V184 (= V189) binding
- T186 (= T191) binding
- RDK 197:199 (≠ RDT 202:204) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
37% identity, 97% coverage: 6:257/261 of query aligns to 7:242/252 of 6vspB
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
37% identity, 97% coverage: 6:257/261 of query aligns to 5:240/251 of 6vspA
- active site: G16 (= G17), S138 (= S143), Y151 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), N15 (≠ R16), G16 (= G17), M17 (≠ I18), D36 (= D37), W37 (≠ R38), W37 (≠ R38), A38 (≠ T39), I59 (≠ V62), D60 (= D63), V61 (= V64), N87 (= N90), A88 (= A91), G89 (= G92), V90 (= V93), V110 (= V113), T136 (= T141), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), S182 (≠ G187), L183 (≠ V188), V184 (= V189), T186 (= T191), N187 (≠ E192), M188 (= M193), T189 (≠ W194)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
36% identity, 98% coverage: 4:260/261 of query aligns to 6:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G13), R18 (= R16), G19 (= G17), I20 (= I18), D39 (= D37), R40 (= R38), C63 (≠ V62), I65 (≠ V64), N91 (= N90), G93 (= G92), I94 (≠ V93), V114 (= V113), Y155 (= Y156), K159 (= K160), I188 (≠ V189), T190 (= T191), T193 (≠ W194)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 98% coverage: 3:257/261 of query aligns to 4:251/255 of 5itvA
- active site: G18 (= G17), S141 (= S143), Y154 (= Y156), K158 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (≠ R16), G18 (= G17), I19 (= I18), D38 (= D37), I39 (≠ R38), T61 (≠ V62), I63 (≠ V64), N89 (= N90), G91 (= G92), T139 (= T141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), I186 (≠ V188), I187 (≠ V189)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
36% identity, 97% coverage: 7:258/261 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G17), S138 (= S143), Q148 (≠ L153), Y151 (= Y156), K155 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ G15), R11 (= R16), I13 (= I18), N31 (≠ A36), Y32 (≠ D37), A33 (≠ R38), G34 (vs. gap), S35 (≠ T39), A58 (≠ V62), N59 (≠ D63), V60 (= V64), N86 (= N90), A87 (= A91), T109 (≠ V113), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187)
Query Sequence
>AZOBR_RS04810 FitnessBrowser__azobra:AZOBR_RS04810
MSNLKDKSIIVTGAGRGIGATMARALAADGARLIIADRTEEDAKTVAESIRAKGGDAVAV
TVDVRDRAAVRRMIDTAVTSFGRLDVLFNNAGVAQTKPFLDITEEDWRFVTDVNALGVLI
GMQEAIKTFRAQGGGGKIINTASIAGKQGYEPLAHYSASKFAVVALTQAAARAFGKEKIT
ANAICPGVVATEMWKIIDKGFRDTGLTTAEDEAFNHFAAGAVLGRPSTAEDLVGVARFLA
SSDSDFMTGQSLLVDGGMVFA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory