Comparing AZOBR_RS04895 FitnessBrowser__azobra:AZOBR_RS04895 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
36% identity, 45% coverage: 285:533/557 of query aligns to 2:247/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
36% identity, 45% coverage: 285:533/557 of query aligns to 2:247/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 45% coverage: 285:533/557 of query aligns to 2:247/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 43% coverage: 286:524/557 of query aligns to 1:235/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 43% coverage: 286:524/557 of query aligns to 2:236/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 43% coverage: 286:524/557 of query aligns to 2:236/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 43% coverage: 286:524/557 of query aligns to 2:236/344 of 6cvlD
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
35% identity, 44% coverage: 285:529/557 of query aligns to 2:258/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
34% identity, 43% coverage: 23:260/557 of query aligns to 27:264/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
35% identity, 41% coverage: 23:251/557 of query aligns to 26:254/310 of 4fwiB
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 41% coverage: 309:534/557 of query aligns to 45:267/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 41% coverage: 309:534/557 of query aligns to 45:267/382 of 7aheC
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 44% coverage: 284:526/557 of query aligns to 15:244/378 of P69874
Sites not aligning to the query:
4hluA Structure of the ecfa-a' heterodimer bound to adp (see paper)
34% identity, 41% coverage: 304:529/557 of query aligns to 21:239/265 of 4hluA
Sites not aligning to the query:
5d3mA Folate ecf transporter: amppnp bound state (see paper)
35% identity, 38% coverage: 305:518/557 of query aligns to 22:231/280 of 5d3mA
Sites not aligning to the query:
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
34% identity, 41% coverage: 305:530/557 of query aligns to 19:235/278 of 8bmpA
Sites not aligning to the query:
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
31% identity, 43% coverage: 286:527/557 of query aligns to 1:227/276 of Q5M243
7ahdC Opua (e190q) occluded (see paper)
31% identity, 39% coverage: 309:527/557 of query aligns to 45:260/260 of 7ahdC
Sites not aligning to the query:
4zirA Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
32% identity, 41% coverage: 304:529/557 of query aligns to 21:237/263 of 4zirA
Sites not aligning to the query:
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
33% identity, 41% coverage: 305:530/557 of query aligns to 19:235/278 of 8bmsA
Sites not aligning to the query:
>AZOBR_RS04895 FitnessBrowser__azobra:AZOBR_RS04895
MTLLRIQNLNLSADSGKPILRDVSLTLEHGQILALIGASGSGKTTLALTALGHMRPGVRH
VSGQVLFQGQDLLRMSRRALARLRGRKLAYIAQSAAVSFNPRIRLDRQVTESSRIHHTMS
PDAAHARAREVYRTLDLPTGEAFYNRFPHEVSGGQLQRFMIAMGLHEMPEILICDEPTSA
LDATTQVEVLKALDTGIRASGTAAILVGHDIAQVVQVATHILVMRNGEVVERGTVEQILH
HPEHPYTRQLLEMHRGFDAESGTMAETVAASATAASPSDRTDRTPLLEVRDLAVCYDTGG
FAVKALSGASLTLNGGEMMAVVGESGSGKSTMARAIAGLVQPSHGDVLVNGRLMERDVLK
RPLPMRRAVQITFQSADTSLNRHHTVGRILGQVLTFFGERSKERRAERIRELLEQVHLPA
DYVDRKPSQMSGGEKQRVNLARSLAARPDVLICDEITSALDNIVAASVLDLINELKRELN
IGILFISHDLSAVAAMSDKIMVLRNGEVVEQGPTAQVLGAPRHPYTRLLRSSVAAMRLGW
LEEASALHRSLRDELGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory