SitesBLAST
Comparing AZOBR_RS05730 FitnessBrowser__azobra:AZOBR_RS05730 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
29% identity, 45% coverage: 6:193/417 of query aligns to 49:228/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (= V30), G75 (= G32), S76 (= S33), G77 (= G34), T78 (≠ S35), G79 (≠ K36), L80 (≠ R37), A83 (≠ L39), C84 (≠ G40), P137 (≠ L96), G138 (= G97), E139 (= E104), A142 (≠ G107), T143 (= T108), G146 (= G111), N147 (≠ V112), S149 (= S114), T150 (≠ C115), A152 (≠ L117), G153 (≠ A118), E203 (≠ F168), G204 (= G169), I209 (≠ L174)
Sites not aligning to the query:
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
26% identity, 42% coverage: 7:183/417 of query aligns to 45:213/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
32% identity, 32% coverage: 82:216/417 of query aligns to 114:262/465 of 3pm9A
- active site: A149 (≠ L117), L159 (≠ S127)
- binding flavin-adenine dinucleotide: L133 (≠ G101), G134 (≠ R102), A135 (≠ P103), C139 (≠ G107), T140 (= T108), G142 (= G110), G143 (= G111), S146 (= S114), T147 (≠ C115), A149 (≠ L117), G150 (≠ A118), E200 (≠ F168), G201 (= G169), I205 (≠ V173), I206 (≠ L174)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 69, 70, 71, 72, 73, 74, 75, 76, 79, 80, 91, 423
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
24% identity, 45% coverage: 6:193/417 of query aligns to 104:284/521 of Q8N465
- S109 (≠ A11) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ D29) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (≠ S33) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ T48) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L54) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ T73) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P93) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ S114) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G140) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G142) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 375 D → Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- 386 binding ; binding ; binding ; R→A: Loss of catalytic activity.
- 390 binding ; binding ; T→A: Significantly reduced catalytic activity.
- 399 V → M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 401 binding ; binding ; K→A: Loss of catalytic activity.
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding ; H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding ; H→A: Loss of catalytic activity.
- 443 binding ; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding ; E→A: Loss of catalytic activity.
- 476 binding ; binding ; binding ; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
24% identity, 45% coverage: 6:193/417 of query aligns to 52:232/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (≠ V30), G78 (= G32), G79 (≠ S33), N80 (≠ G34), T81 (≠ S35), G82 (≠ K36), M83 (≠ R37), G86 (≠ L39), S87 (≠ G40), L140 (= L96), A142 (≠ P98), C146 (≠ G107), H147 (≠ T108), G150 (= G111), N151 (≠ V112), A153 (≠ S114), T154 (≠ C115), G208 (= G169), I212 (≠ V173), I213 (≠ L174)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
24% identity, 45% coverage: 6:193/417 of query aligns to 51:231/466 of 6lpxA
- binding flavin-adenine dinucleotide: P75 (≠ V30), Q76 (≠ A31), G77 (= G32), G78 (≠ S33), N79 (≠ G34), T80 (≠ S35), G81 (≠ K36), M82 (≠ R37), G85 (≠ L39), S86 (≠ G40), L139 (= L96), G140 (= G97), A141 (≠ P98), C145 (≠ G107), G149 (= G111), N150 (≠ V112), A152 (≠ S114), T153 (≠ C115), G157 (= G119), G207 (= G169), I212 (≠ L174)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
24% identity, 45% coverage: 6:193/417 of query aligns to 51:231/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (≠ V30), G77 (= G32), G78 (≠ S33), N79 (≠ G34), T80 (≠ S35), G81 (≠ K36), G85 (≠ L39), S86 (≠ G40), L139 (= L96), G140 (= G97), A141 (≠ P98), C145 (≠ G107), H146 (≠ T108), G148 (= G110), G149 (= G111), N150 (≠ V112), A152 (≠ S114), T153 (≠ C115), A155 (≠ L117), E206 (≠ F168), G207 (= G169), I211 (≠ V173), I212 (≠ L174)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
24% identity, 45% coverage: 6:193/417 of query aligns to 51:231/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (≠ V30), G77 (= G32), G78 (≠ S33), N79 (≠ G34), T80 (≠ S35), G81 (≠ K36), G85 (≠ L39), S86 (≠ G40), L139 (= L96), G140 (= G97), A141 (≠ P98), C145 (≠ G107), H146 (≠ T108), G149 (= G111), N150 (≠ V112), A152 (≠ S114), T153 (≠ C115), A155 (≠ L117), G157 (= G119), E206 (≠ F168), G207 (= G169), I211 (≠ V173), I212 (≠ L174)
- binding d-malate: M82 (≠ R37)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding d-malate: 333, 337, 348, 379, 381, 388, 422, 423
- binding zinc ion: 381, 388, 422
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
24% identity, 45% coverage: 6:193/417 of query aligns to 51:231/466 of 6lppA
- binding flavin-adenine dinucleotide: P75 (≠ V30), G77 (= G32), G78 (≠ S33), N79 (≠ G34), T80 (≠ S35), G81 (≠ K36), M82 (≠ R37), G85 (≠ L39), S86 (≠ G40), L139 (= L96), G140 (= G97), A141 (≠ P98), C145 (≠ G107), G149 (= G111), N150 (≠ V112), A152 (≠ S114), T153 (≠ C115), A155 (≠ L117), G157 (= G119), G207 (= G169), I212 (≠ L174)
Sites not aligning to the query:
- binding (2R)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 390, 423
- binding flavin-adenine dinucleotide: 39, 422, 423
- binding zinc ion: 381, 388, 422
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 36% coverage: 63:211/417 of query aligns to 112:269/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Query Sequence
>AZOBR_RS05730 FitnessBrowser__azobra:AZOBR_RS05730
MTVTTVKPDSAAQAADAVRWALSEGTPLDVAGSGSKRGLGRPIQTAYTLDLSGLSGVVAY
EAEELVLTARAGTPMAEILPMLAERRQQFAFEPQDLGPLFGRPEGQGTLGGVISCGLAGP
RRISAGSARDHTLGIEGVNGRGDLYKGGGKVVKNVTGYDVPKLMAGSFGTLTVLTELTVK
VLPASEDVRTLLLAGREDAGAVAALTAALQSPYDVSGAAHLPAAVAARSHVRAVAAVGGA
VTLVRVEGFGPSVIARVAALKEELGADAVLDRDESLAVWKEVRDVAYFGPTPSPASAGEG
WGGGEDSRHIWKISVQPSEGPRVAESIRWALDAELYFDWGGGLIWAAVAPTPDAASAIRG
ALGTAGHATLVRAPEDVRTTTEVFHPLPDPVKALSRRVKESFDPCGILNPGRMYAGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory