SitesBLAST
Comparing AZOBR_RS05905 FitnessBrowser__azobra:AZOBR_RS05905 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 90% coverage: 24:260/263 of query aligns to 6:244/247 of 4jroC
- active site: G16 (= G34), S142 (= S158), Q152 (≠ V168), Y155 (= Y171), K159 (= K175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G30), S14 (= S32), R15 (= R33), G16 (= G34), I17 (≠ L35), N35 (≠ F53), Y36 (≠ S54), N37 (≠ R55), G38 (= G56), S39 (≠ T57), N63 (≠ D79), V64 (≠ L80), N90 (= N106), A91 (= A107), I93 (≠ L109), I113 (≠ A129), S142 (= S158), Y155 (= Y171), K159 (= K175), P185 (= P201), I188 (≠ F204), T190 (= T206)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
38% identity, 90% coverage: 24:260/263 of query aligns to 5:243/246 of 3osuA
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
36% identity, 90% coverage: 24:260/263 of query aligns to 9:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G30), S17 (= S32), R18 (= R33), I20 (≠ L35), T40 (≠ R55), N62 (≠ D79), V63 (≠ L80), N89 (= N106), A90 (= A107), I92 (≠ L109), V139 (= V156), S141 (= S158), Y154 (= Y171), K158 (= K175), P184 (= P201), G185 (= G202), I187 (≠ F204), T189 (= T206), M191 (≠ L208)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 90% coverage: 24:260/263 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G34), S138 (= S158), Q148 (≠ V168), Y151 (= Y171), K155 (= K175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G30), S10 (= S32), R11 (= R33), I13 (≠ L35), N31 (≠ F53), Y32 (≠ S54), A33 (≠ R55), G34 (= G56), S35 (≠ T57), A58 (= A78), N59 (≠ D79), V60 (≠ L80), N86 (= N106), A87 (= A107), T109 (≠ A129), S138 (= S158), Y151 (= Y171), K155 (= K175), P181 (= P201), G182 (= G202)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
37% identity, 90% coverage: 24:260/263 of query aligns to 6:240/244 of 6t77A
- active site: G16 (= G34), S138 (= S158), Y151 (= Y171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G30), S14 (= S32), R15 (= R33), T37 (≠ R55), L58 (≠ W75), N59 (≠ Q76), V60 (≠ Q77), A87 (= A107), G88 (≠ A108), I89 (≠ L109)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 90% coverage: 24:260/263 of query aligns to 6:240/244 of P0A2C9
- M125 (= M145) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A243) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S244) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 90% coverage: 24:260/263 of query aligns to 6:240/244 of P0AEK2
- GASR 12:15 (≠ GGSR 30:33) binding
- T37 (≠ R55) binding
- NV 59:60 (≠ QQ 76:77) binding
- N86 (= N106) binding
- Y151 (= Y171) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YTASK 171:175) binding
- A154 (≠ S174) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K175) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ F204) binding
- E233 (≠ Q253) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
35% identity, 90% coverage: 24:260/263 of query aligns to 5:239/243 of 1q7bA
- active site: G15 (= G34), E101 (≠ T122), S137 (= S158), Q147 (≠ V168), Y150 (= Y171), K154 (= K175)
- binding calcium ion: E232 (≠ Q253), T233 (= T254)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G30), S13 (= S32), R14 (= R33), T36 (≠ R55), N58 (≠ Q76), V59 (≠ Q77), N85 (= N106), A86 (= A107), G87 (≠ A108), I88 (≠ L109), S137 (= S158), Y150 (= Y171), K154 (= K175), P180 (= P201), G181 (= G202), I183 (≠ F204)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
35% identity, 90% coverage: 24:260/263 of query aligns to 9:239/243 of 4i08A
- active site: G19 (= G34), N113 (= N130), S141 (= S158), Q151 (≠ V168), Y154 (= Y171), K158 (= K175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G30), S17 (= S32), R18 (= R33), I20 (≠ L35), T40 (≠ R55), N62 (≠ D79), V63 (≠ L80), N89 (= N106), A90 (= A107), G140 (≠ S157), S141 (= S158), Y154 (= Y171), K158 (= K175), P184 (= P201), G185 (= G202), T189 (= T206)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
35% identity, 90% coverage: 24:260/263 of query aligns to 5:239/243 of 1q7cA
- active site: G15 (= G34), S137 (= S158), Q147 (≠ V168), F150 (≠ Y171), K154 (= K175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G30), S13 (= S32), R14 (= R33), A35 (≠ S54), T36 (≠ R55), L57 (≠ W75), N58 (≠ Q76), V59 (≠ Q77), G87 (≠ A108), I88 (≠ L109)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 90% coverage: 23:260/263 of query aligns to 7:241/244 of 4nbuB
- active site: G18 (= G34), N111 (= N130), S139 (= S158), Q149 (≠ V168), Y152 (= Y171), K156 (= K175)
- binding acetoacetyl-coenzyme a: D93 (≠ E112), K98 (≠ T117), S139 (= S158), N146 (≠ H165), V147 (≠ P166), Q149 (≠ V168), Y152 (= Y171), F184 (= F203), M189 (≠ L208), K200 (≠ R219)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G30), N17 (≠ R33), G18 (= G34), I19 (≠ L35), D38 (≠ T52), F39 (= F53), V59 (≠ A78), D60 (= D79), V61 (≠ L80), N87 (= N106), A88 (= A107), G89 (≠ A108), I90 (≠ L109), T137 (≠ V156), S139 (= S158), Y152 (= Y171), K156 (= K175), P182 (= P201), F184 (= F203), T185 (≠ F204), T187 (= T206), M189 (≠ L208)
Q8N4T8 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit; KAR beta subunit; Carbonyl reductase family member 4; CBR4; Quinone reductase CBR4; Short chain dehydrogenase/reductase family 45C member 1; EC 1.1.1.100; EC 1.6.5.10 from Homo sapiens (Human) (see 4 papers)
33% identity, 90% coverage: 23:260/263 of query aligns to 2:232/237 of Q8N4T8
- G9 (= G30) mutation to S: Unable to restore growth of an OAR1-deficient yeast mutant.
- SRGI 11:14 (≠ SRGL 32:35) binding
- R12 (= R33) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant.
- R34 (= R55) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Strongly reduces NADPH-dependent reductase activity with acetoacetyl-CoA and 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- RN 34:35 (≠ RG 55:56) binding
- D56 (= D79) binding
- L70 (≠ V93) to M: in dbSNP:rs2877380
- AAG 83:85 (≠ NAA 106:108) binding
- S135 (= S158) mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- Y148 (= Y171) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- K152 (= K175) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant. Abolishes NADPH-dependent reductase activity with acetoacetyl-CoA. Strongly reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- R168 (≠ P191) mutation to E: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- K169 (≠ L192) mutation to E: Unable to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- VHT 181:183 (≠ FET 204:206) binding
4cqmF Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
33% identity, 90% coverage: 23:260/263 of query aligns to 6:236/241 of 4cqmF
- active site: G17 (= G34), S139 (= S158), Q149 (≠ V168), Y152 (= Y171), K156 (= K175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G30), R16 (= R33), G17 (= G34), I18 (≠ L35), A37 (≠ S54), R38 (= R55), N39 (≠ G56), D60 (= D79), V61 (≠ L80), A87 (≠ N106), A88 (= A107), G89 (≠ A108), V137 (= V156), S139 (= S158), Y152 (= Y171), K156 (= K175), V185 (≠ F204), T187 (= T206), M189 (≠ L208)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
34% identity, 90% coverage: 24:260/263 of query aligns to 5:239/243 of 7emgB
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
32% identity, 90% coverage: 24:260/263 of query aligns to 6:240/244 of 6t62A
- active site: G16 (= G34), S138 (= S158), Y151 (= Y171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G30), S14 (= S32), R15 (= R33), A36 (≠ S54), T37 (≠ R55), L58 (≠ A78), D59 (= D79), V60 (≠ L80), N86 (= N106), A87 (= A107), G88 (≠ A108), I89 (≠ L109), I136 (≠ V156), S137 (= S157), S138 (= S158), Y151 (= Y171), K155 (= K175), P181 (= P201), G182 (= G202), I184 (≠ F204), M188 (≠ L208)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
32% identity, 90% coverage: 24:260/263 of query aligns to 6:240/244 of 6wprA
- active site: G16 (= G34), S138 (= S158), Y151 (= Y171)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G30), S14 (= S32), R15 (= R33), T37 (≠ R55), L58 (≠ A78), D59 (= D79), V60 (≠ L80), N86 (= N106), A87 (= A107), G88 (≠ A108), I89 (≠ L109), I136 (≠ V156), Y151 (= Y171), K155 (= K175), P181 (= P201)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
32% identity, 91% coverage: 24:262/263 of query aligns to 6:246/248 of 6ixmC
- active site: G16 (= G34), S142 (= S158), Y155 (= Y171), K159 (= K175)
- binding nicotinamide-adenine-dinucleotide: G12 (= G30), S15 (≠ R33), G16 (= G34), I17 (≠ L35), D36 (≠ T52), I37 (≠ F53), A61 (= A78), D62 (= D79), T63 (≠ L80), N89 (= N106), A90 (= A107), M140 (≠ V156), S142 (= S158), Y155 (= Y171), K159 (= K175), P185 (= P201), A186 (≠ G202), Y187 (≠ F203), I188 (≠ F204), L192 (= L208)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
35% identity, 90% coverage: 24:260/263 of query aligns to 7:243/247 of P73574
- A14 (≠ G31) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P166) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K175) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (= F203) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ T213) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
37% identity, 90% coverage: 24:260/263 of query aligns to 6:236/239 of 4nbtA
- active site: G16 (= G34), S132 (= S158), Y145 (= Y171), K149 (= K175)
- binding nicotinamide-adenine-dinucleotide: G12 (= G30), K15 (≠ R33), G16 (= G34), L17 (= L35), D36 (≠ S54), L37 (≠ R55), L52 (≠ W75), N53 (≠ Q76), V54 (≠ Q77), N80 (= N106), A81 (= A107), G82 (≠ A108), I130 (≠ V156), S132 (= S158), Y145 (= Y171), K149 (= K175), P177 (= P201), G178 (= G202), I180 (≠ F204), T182 (= T206)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
35% identity, 90% coverage: 24:260/263 of query aligns to 13:250/254 of 4ag3A
- active site: G23 (= G34), S148 (= S158), Y161 (= Y171), K165 (= K175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G30), S21 (= S32), R22 (= R33), G23 (= G34), I24 (≠ L35), T44 (≠ R55), L68 (≠ W75), D69 (= D79), V70 (≠ L80), N96 (= N106), A97 (= A107), I146 (≠ V156), S148 (= S158), Y161 (= Y171), K165 (= K175), P191 (= P201), G192 (= G202), F193 (= F203), I194 (≠ F204), T196 (= T206), M198 (≠ L208), T199 (≠ V209)
Query Sequence
>AZOBR_RS05905 FitnessBrowser__azobra:AZOBR_RS05905
MNGRSLSQDAPPTGSAPPPSPAERVAVVSGGSRGLGFVLVQRLLDEGWGVATFSRGTPGA
DIEALQARSGSRLFWQQADLRLPESLHSFAKAVVRRFGRIDLLINNAALLTEGLLATTRG
TTVADVIAANLVGPIALSQACVKPMMQQRRGTIVNVSSINSVRGHPGVSIYTASKAGLDG
FTRSMARELGPLNIRVNSIVPGFFETDLVAALTAERRDRIARRTPLKRVAEIGEIADVAM
FLASDRSSFVTGQTIIVDGGYTC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory