SitesBLAST
Comparing AZOBR_RS06155 FitnessBrowser__azobra:AZOBR_RS06155 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1mtoA Crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate (see paper)
40% identity, 94% coverage: 5:343/361 of query aligns to 2:307/319 of 1mtoA
- active site: G11 (= G14), R72 (≠ N79), C73 (≠ R80), D103 (= D118), G104 (= G119), G124 (≠ K140), T125 (= T141), D127 (= D143), D129 (= D145), R171 (= R187)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D143), R162 (= R178), M169 (= M185), R171 (= R187), E222 (= E238), R243 (= R279), H249 (= H285), R252 (= R288)
6pfkA Phosphofructokinase, inhibited t-state (see paper)
40% identity, 94% coverage: 5:343/361 of query aligns to 2:307/319 of 6pfkA
- active site: G11 (= G14), R72 (≠ N79), C73 (≠ R80), D103 (= D118), G104 (= G119), G124 (≠ K140), T125 (= T141), D127 (= D143), D129 (= D145), R171 (= R187)
- binding 2-phosphoglycolic acid: R21 (= R24), R25 (≠ H28), G58 (= G65), D59 (≠ N66), R154 (≠ Q170), R211 (≠ T227), K213 (≠ R229)
P00512 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
40% identity, 94% coverage: 5:343/361 of query aligns to 2:307/319 of P00512
- RSVVR 21:25 (≠ RAVVH 24:28) binding
- D59 (≠ N66) binding
- RC 72:73 (≠ NR 79:80) binding
- D103 (= D118) binding
- TID 125:127 (= TID 141:143) binding in other chain
- R154 (≠ Q170) binding in other chain
- R162 (= R178) binding
- MGR 169:171 (= MGR 185:187) binding in other chain
- GAE 185:187 (≠ GAD 201:203) binding in other chain
- R211 (≠ T227) binding in other chain
- KKH 213:215 (≠ RNF 229:231) binding in other chain
- E222 (= E238) binding in other chain
- R243 (= R279) binding
- HVQR 249:252 (= HVQR 285:288) binding in other chain
4pfkA Phosphofructokinase. Structure and control (see paper)
40% identity, 94% coverage: 5:343/361 of query aligns to 2:307/319 of 4pfkA
- active site: G11 (= G14), R72 (≠ N79), C73 (≠ R80), D103 (= D118), G104 (= G119), G124 (≠ K140), T125 (= T141), D127 (= D143), D129 (= D145), R171 (= R187)
- binding adenosine-5'-diphosphate: S9 (= S12), Y41 (≠ T45), R72 (≠ N79), C73 (≠ R80), F76 (≠ Y86), K77 (≠ P87), G104 (= G119), G108 (≠ I123), R154 (≠ Q170), G185 (= G201), R211 (≠ T227), G212 (= G228), K213 (≠ R229), H215 (≠ F231)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D143), M169 (= M185), E222 (= E238), H249 (= H285), R252 (= R288)
- binding magnesium ion: G185 (= G201), E187 (≠ D203)
3pfkA Phosphofructokinase. Structure and control (see paper)
40% identity, 94% coverage: 5:343/361 of query aligns to 2:307/319 of 3pfkA
- active site: G11 (= G14), R72 (≠ N79), C73 (≠ R80), D103 (= D118), G104 (= G119), G124 (≠ K140), T125 (= T141), D127 (= D143), D129 (= D145), R171 (= R187)
- binding phosphate ion: R154 (≠ Q170), K213 (≠ R229), H249 (= H285), R252 (= R288)
4i4iA Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep (see paper)
40% identity, 94% coverage: 5:343/361 of query aligns to 2:307/319 of 4i4iA
- active site: G11 (= G14), R72 (≠ N79), C73 (≠ R80), D103 (= D118), G104 (= G119), G124 (≠ K140), T125 (= T141), D127 (= D143), D129 (= D145), R171 (= R187)
- binding phosphoenolpyruvate: R21 (= R24), R25 (≠ H28), G58 (= G65), R154 (≠ Q170), R211 (≠ T227), K213 (≠ R229), H215 (≠ F231)
1pfkA Crystal structure of the complex of phosphofructokinase from escherichia coli with its reaction products (see paper)
39% identity, 92% coverage: 5:336/361 of query aligns to 3:301/320 of 1pfkA
- active site: G12 (= G14), R73 (≠ N79), F74 (≠ Y86), D104 (= D118), G105 (= G119), G125 (≠ K140), T126 (= T141), D128 (= D143), D130 (= D145), R172 (= R187)
- binding adenosine-5'-diphosphate: G11 (= G13), R22 (= R24), R26 (= R29), Y56 (≠ P61), S59 (≠ G65), D60 (≠ N66), R73 (≠ N79), F74 (≠ Y86), F77 (≠ D95), R78 (= R96), G103 (= G117), D104 (= D118), G105 (= G119), S106 (= S120), M108 (≠ A122), G109 (≠ I123), R155 (≠ Q170), G213 (= G228), K214 (≠ R229), H216 (≠ F231)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: G12 (= G14), R73 (≠ N79), T126 (= T141), D128 (= D143), M170 (= M185), E223 (= E238), H250 (= H285), R253 (= R288)
- binding magnesium ion: G186 (= G201), E188 (≠ D203)
P0A796 ATP-dependent 6-phosphofructokinase isozyme 1; ATP-PFK 1; Phosphofructokinase 1; 6-phosphofructokinase isozyme I; Phosphohexokinase 1; Sedoheptulose-7-phosphate kinase; EC 2.7.1.11 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 92% coverage: 5:336/361 of query aligns to 3:301/320 of P0A796
- G12 (= G14) binding
- RGVV-R 22:26 (≠ RAVVHR 24:29) binding
- RYSV-SD 55:60 (≠ LPQVDGN 60:66) binding
- R------F 73:74 (≠ NRGDPFAY 79:86) binding
- GDGS 103:106 (= GDGS 117:120) binding
- D104 (= D118) binding
- TID 126:128 (= TID 141:143) binding in other chain
- D128 (= D143) active site, Proton acceptor; mutation to S: 18000-fold reduction of catalytic rate.
- R155 (≠ Q170) binding in other chain
- R163 (= R178) binding
- R172 (= R187) mutation to S: 3.4-fold reduction in turnover numbers.
- GCE 186:188 (≠ GAD 201:203) binding in other chain
- KKH 214:216 (≠ RNF 229:231) binding in other chain
- E223 (= E238) binding in other chain
- R244 (= R279) binding
- HIQR 250:253 (≠ HVQR 285:288) binding in other chain
5xz7A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
33% identity, 98% coverage: 5:357/361 of query aligns to 2:318/322 of 5xz7A
5xz6A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
33% identity, 98% coverage: 5:357/361 of query aligns to 2:318/318 of 5xz6A
5xz9A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
34% identity, 91% coverage: 5:334/361 of query aligns to 2:300/321 of 5xz9A
- binding adenosine-5'-triphosphate: S9 (= S12), Y41 (≠ T45), C73 (≠ M88), F76 (≠ G91), K77 (≠ T92), G102 (= G117), D103 (= D118), G104 (= G119), S105 (= S120), R107 (≠ A122), G108 (≠ I123)
5xzaA Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp (see paper)
34% identity, 91% coverage: 5:334/361 of query aligns to 2:300/322 of 5xzaA
Q2FXM8 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
34% identity, 91% coverage: 5:334/361 of query aligns to 2:300/322 of Q2FXM8
- RC 72:73 (≠ PM 87:88) binding
- GDGS 102:105 (= GDGS 117:120) binding
- TID 127:129 (= TID 141:143) binding in other chain
- G150 (≠ E164) mutation to D: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of dimer conversion; in association with A-151.
- L151 (≠ A165) mutation to A: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of tetramer-dimer conversion; in association with D-150.
- R164 (= R178) mutation to A: Complete loss of fructose 6-phosphate binding.
- MGR 171:173 (= MGR 185:187) binding in other chain
- E224 (= E238) binding in other chain
- R245 (= R279) mutation to A: Complete loss of fructose 6-phosphate binding.
- HVQR 251:254 (= HVQR 285:288) binding in other chain
P08237 ATP-dependent 6-phosphofructokinase, muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 6 papers)
31% identity, 92% coverage: 4:336/361 of query aligns to 15:352/780 of P08237
- R39 (≠ H28) to P: in GSD7; Italian; dbSNP:rs121918193
- G57 (= G47) to V: in GSD7; Italian
- R100 (≠ I101) to Q: in dbSNP:rs2228500
- S180 (≠ T157) to C: in GSD7; Italian
- G209 (= G186) to D: in GSD7; loss of activity shown by complementation assays in yeast; dbSNP:rs767265360
- D309 (= D296) to G: in GSD7; Spanish; complete loss of enzyme activity; dbSNP:rs1169383137
Sites not aligning to the query:
- 543 D → A: in GSD7; Italian; dbSNP:rs121918194
- 557 modified: N6-(2-hydroxyisobutyryl)lysine
- 591 D → A: in GSD7; Italian
- 686 W → C: in GSD7; Japanese; dbSNP:rs121918196
- 696 R → H: in dbSNP:rs41291971
4xyjF Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
32% identity, 93% coverage: 3:336/361 of query aligns to 9:347/761 of 4xyjF
- active site: G20 (= G14), R83 (≠ N79), C84 (≠ R80), D114 (= D118), G158 (≠ K140), S159 (≠ T141), D161 (= D143), D163 (= D145), R205 (= R187)
- binding adenosine-5'-triphosphate: G20 (= G14), Y50 (≠ T45), R83 (≠ N79), C84 (≠ R80), F87 (≠ Y86), R88 (≠ P87), G113 (= G117), D114 (= D118), G115 (= G119), S116 (= S120), G119 (vs. gap), S159 (≠ T141)
- binding magnesium ion: G19 (= G13), G20 (= G14), G112 (= G116), D114 (= D118), G158 (≠ K140), D163 (= D145), R205 (= R187)
- binding phosphate ion: R30 (= R24), R34 (= R29), S69 (≠ G65), S70 (≠ N66), G219 (= G201), K250 (≠ R229)
Sites not aligning to the query:
4xyjA Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
32% identity, 93% coverage: 3:336/361 of query aligns to 11:349/768 of 4xyjA
- active site: G22 (= G14), R85 (≠ N79), C86 (≠ R80), D116 (= D118), G160 (≠ K140), S161 (≠ T141), D163 (= D143), D165 (= D145), R207 (= R187)
- binding adenosine-5'-triphosphate: G21 (= G13), G22 (= G14), Y52 (≠ T45), C86 (≠ R80), F89 (≠ Y86), R90 (≠ P87), G115 (= G117), D116 (= D118), G117 (= G119), S118 (= S120), G121 (vs. gap), S161 (≠ T141), R207 (= R187)
- binding magnesium ion: G21 (= G13), G22 (= G14), D116 (= D118), D165 (= D145)
- binding phosphate ion: R32 (= R24), R36 (= R29), S72 (≠ N66), G221 (= G201), K252 (≠ R229)
Sites not aligning to the query:
Q01813 ATP-dependent 6-phosphofructokinase, platelet type; ATP-PFK; PFK-P; 6-phosphofructokinase type C; Phosphofructo-1-kinase isozyme C; PFK-C; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see paper)
32% identity, 93% coverage: 3:336/361 of query aligns to 23:361/784 of Q01813
Sites not aligning to the query:
- 386 modified: Phosphoserine; S→A: Decreased interaction with ATG4B.
4xykA Crystal structure of human phosphofructokinase-1 in complex with adp, northeast structural genomics consortium target hr9275 (see paper)
32% identity, 93% coverage: 3:336/361 of query aligns to 7:345/737 of 4xykA
- active site: G18 (= G14), R81 (≠ N79), C82 (≠ R80), D112 (= D118), G156 (≠ K140), S157 (≠ T141), D159 (= D143), D161 (= D145), R203 (= R187)
- binding adenosine-5'-diphosphate: Y48 (≠ T45), R81 (≠ N79), C82 (≠ R80), R86 (≠ P87), G111 (= G117), D112 (= D118), G113 (= G119), S114 (= S120)
- binding phosphate ion: R28 (= R24), R32 (= R29), S67 (≠ G65), K248 (≠ R229)
Sites not aligning to the query:
7lw1A Human phosphofructokinase-1 liver type bound to activator na-11 (see paper)
31% identity, 93% coverage: 3:336/361 of query aligns to 4:342/744 of 7lw1A
- binding adenosine-5'-diphosphate: R78 (≠ N79), C79 (≠ R80), T83 (≠ P87), G108 (= G117), G110 (= G119), S111 (= S120), G114 (vs. gap), I117 (vs. gap)
- binding 6-O-phosphono-beta-D-fructofuranose: I155 (= I142), D156 (= D143), R191 (= R178), M198 (= M185), R200 (= R187), E254 (= E238), R282 (= R279), H288 (= H285), R291 (= R288)
- binding N-{(11S)-2-[2-(5-hydroxypent-1-yn-1-yl)phenyl]-4H,10H-pyrazolo[5,1-c][1,4]benzoxazepin-7-yl}acetamide: M164 (≠ V151), F298 (≠ R295), I301 (≠ L298), K305 (≠ A302), N331 (≠ R325)
Sites not aligning to the query:
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: 399, 460, 519, 555, 562, 618, 644, 650, 724
- binding N-{(11S)-2-[2-(5-hydroxypent-1-yn-1-yl)phenyl]-4H,10H-pyrazolo[5,1-c][1,4]benzoxazepin-7-yl}acetamide: 527, 532, 535, 568, 660, 730, 734
P17858 ATP-dependent 6-phosphofructokinase, liver type; ATP-PFK; PFK-L; 6-phosphofructokinase type B; Phosphofructo-1-kinase isozyme B; PFK-B; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 3 papers)
31% identity, 93% coverage: 3:336/361 of query aligns to 14:352/780 of P17858
- G81 (= G72) natural variant: G -> A
- R151 (vs. gap) to W: in dbSNP:rs755851304
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 527 T→A: Does not affect GlcNAcylation.
- 529 modified: carbohydrate, O-linked (GlcNAc) serine; S→A: Prevents GlcNAcylation and enhance enzyme activity.
Query Sequence
>AZOBR_RS06155 FitnessBrowser__azobra:AZOBR_RS06155
MTAGKRIGILTSGGDCAGLNAVIRAVVHRAVLTYGWQVLGIKEGTQGLLQRPVQYQVLDL
PQVDGNMMRMGGTILGTTNRGDPFAYPMADGTQKDRSDEIIGGYRELGLDALIGIGGDGS
FAILKKLADKGGFQMVGIPKTIDNDLGLTEVSVGYDTAVGVAVEALDRLQPTAASHARVM
VLEVMGRDAGHIALAAGIAGGADVVLIPEIAYSIEKIAQKIKQVRSTGRNFALVVVSEAV
KTVDGTGVQKLFQGGQKRYGGIGDYIGEKIAEATGAETRVTVLGHVQRGSMPSPRDRLVA
SAFGVHAVDLIAEGKFDRMVAWSDRGVIDVPITEAIAKYACVELDGAMVKTARGLGISLG
D
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory