Comparing AZOBR_RS06415 FitnessBrowser__azobra:AZOBR_RS06415 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1i7qA Anthranilate synthase from s. Marcescens (see paper)
33% identity, 64% coverage: 49:516/737 of query aligns to 29:507/517 of 1i7qA
1i1qA Structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium (see paper)
33% identity, 64% coverage: 47:516/737 of query aligns to 27:506/512 of 1i1qA
P00898 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
33% identity, 64% coverage: 47:516/737 of query aligns to 31:510/520 of P00898
Sites not aligning to the query:
1i7sA Anthranilate synthase from serratia marcescens in complex with its end product inhibitor l-tryptophan (see paper)
34% identity, 61% coverage: 67:516/737 of query aligns to 41:501/511 of 1i7sA
Sites not aligning to the query:
P00897 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Serratia marcescens (see paper)
33% identity, 64% coverage: 49:516/737 of query aligns to 31:509/519 of P00897
P32068 Anthranilate synthase alpha subunit 1, chloroplastic; Anthranilate synthase component 1-1; Anthranilate synthase component I-1; Protein A-METHYL TRYPTOPHAN RESISTANT 1; Protein JASMONATE-INDUCED DEFECTIVE LATERAL ROOT 1; Protein TRYPTOPHAN BIOSYNTHESIS 5; Protein WEAK ETHYLENE INSENSITIVE 2; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 49% coverage: 157:516/737 of query aligns to 186:585/595 of P32068
Q94GF1 Anthranilate synthase alpha subunit 1, chloroplastic; OsASA1; EC 4.1.3.27 from Oryza sativa subsp. japonica (Rice) (see paper)
32% identity, 49% coverage: 157:516/737 of query aligns to 168:567/577 of Q94GF1
A0QX93 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
39% identity, 35% coverage: 253:511/737 of query aligns to 251:510/524 of A0QX93
O94582 Probable anthranilate synthase component 1; Anthranilate synthase component I; EC 4.1.3.27 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 46% coverage: 163:504/737 of query aligns to 107:462/489 of O94582
Sites not aligning to the query:
7bvdA Anthranilate synthase component i (trpe)[mycolicibacterium smegmatis]
39% identity, 35% coverage: 253:511/737 of query aligns to 230:485/499 of 7bvdA
Sites not aligning to the query:
5cwaA Structure of anthranilate synthase component i (trpe) from mycobacterium tuberculosis with inhibitor bound (see paper)
39% identity, 35% coverage: 253:511/737 of query aligns to 230:489/505 of 5cwaA
7pi1DDD Aminodeoxychorismate synthase component 1
32% identity, 38% coverage: 237:517/737 of query aligns to 179:454/459 of 7pi1DDD
Sites not aligning to the query:
P28820 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Bacillus subtilis (strain 168) (see paper)
32% identity, 38% coverage: 237:517/737 of query aligns to 186:461/470 of P28820
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
44% identity, 24% coverage: 534:710/737 of query aligns to 1:177/673 of 8hx8A
Sites not aligning to the query:
Q42565 Anthranilate synthase beta subunit 1, chloroplastic; Anthranilate synthase component 2-1; Anthranilate synthase, glutamine amidotransferase component 2-1; Protein TRYPTOPHAN BIOSYNTHESIS 4; Protein WEAK ETHYLENE INSENSITIVE 7; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
38% identity, 26% coverage: 539:733/737 of query aligns to 75:276/276 of Q42565
P05041 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Escherichia coli (strain K12) (see 4 papers)
30% identity, 46% coverage: 163:504/737 of query aligns to 105:439/453 of P05041
Sites not aligning to the query:
P00903 Aminodeoxychorismate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85 from Escherichia coli (strain K12) (see paper)
39% identity, 26% coverage: 539:726/737 of query aligns to 2:187/187 of P00903
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
32% identity, 36% coverage: 248:516/737 of query aligns to 367:631/632 of 8hx9A
Sites not aligning to the query:
P00900 Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 from Serratia marcescens (see 3 papers)
40% identity, 24% coverage: 539:713/737 of query aligns to 4:179/193 of P00900
Sites not aligning to the query:
1i7qB Anthranilate synthase from s. Marcescens (see paper)
40% identity, 24% coverage: 539:713/737 of query aligns to 3:178/192 of 1i7qB
>AZOBR_RS06415 FitnessBrowser__azobra:AZOBR_RS06415
MYPADLLASPSLLEPLRFQTRGGVAVTRCATALDPQGALDPVIDALDRRRGLLLSSGVEA
PGRYRRHALGFTDPPLAVTARGRTLRIDALNARGRVLLPAVAEALRGLEALAGLEEAPSR
VTALVRKPQHPFPEEERSRQPSLFSVLRAVLNLFAAPDDPLLGLYGAFAYDLAFQFEPIR
LRLERPDDQRDLVLYLPDRLVVLDPVAGLARLVEYEFATAAGSTEGLERAGRDHPYRPDT
NAEGGCDHAPGAYQRVVETAKAAFRRGDLFEVVPGQTFAEPCADAPSAVFRRLRAANPAP
YEAFVNLGRGEFLVAASPEMYVRVAGGRMGGRVETCPISGTVARGADALGDAAQVLRLLT
SAKDAAELTMCTDVDRNDKARVCEPGSVRVIGRRMIELYSRLIHTVDHVEGRLRPGLDAL
DAFLTHTWAVTVTGAPKRWAMQFLEDTEQSPRRWYGGAFGRLGFDGGMDTGLTLRTIRMA
EGVAYVRAGATLLSDSDPDAEDAECRLKAAAFRDAIRGVTEGVACALPAAPNGGRGRRVL
LVDHDDSFVHTLADYLRQTGASVMTLRHGHARAALAERRPDLVVLSPGPGRPADFNVAGT
IDAALALGLPVFGVCLGLQGMVERFGGALDVLPEPVHGKATEVRVLGGALFAGLPERMRV
GRYHSLVARRDRLPADLTVTAETADGLVMAVEHRRLPLAAVQFHPESILSLDGGAGLALL
GNVMDRLAAGALTDAAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory