SitesBLAST
Comparing AZOBR_RS06645 FitnessBrowser__azobra:AZOBR_RS06645 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3odgA Crystal structure of xanthosine phosphorylase bound with xanthine from yersinia pseudotuberculosis
51% identity, 95% coverage: 5:266/277 of query aligns to 8:269/273 of 3odgA
- active site: S30 (= S27), H61 (= H58), H83 (= H80), Y85 (= Y82), E86 (= E83), A113 (= A110), M211 (= M208), S212 (= S209), N235 (= N232), A237 (≠ G234), H247 (= H244)
- binding xanthine: A114 (= A111), G115 (= G112), F192 (= F189), E193 (= E190), G210 (= G207), M211 (= M208), T234 (= T231), N235 (= N232)
1yr3A Escherichia coli purine nucleoside phosphorylase ii, the product of the xapa gene (see paper)
52% identity, 91% coverage: 15:266/277 of query aligns to 18:269/273 of 1yr3A
- active site: S30 (= S27), H61 (= H58), H83 (= H80), Y85 (= Y82), E86 (= E83), A113 (= A110), M211 (= M208), S212 (= S209), N235 (= N232), A237 (≠ G234), H247 (= H244)
- binding xanthine: A114 (= A111), E193 (= E190), G210 (= G207), N235 (= N232)
1yqqA Escherichia coli purine nucleoside phosphorylase ii, the product of the xapa gene (see paper)
52% identity, 91% coverage: 15:266/277 of query aligns to 18:269/273 of 1yqqA
- active site: S30 (= S27), H61 (= H58), H83 (= H80), Y85 (= Y82), E86 (= E83), A113 (= A110), M211 (= M208), S212 (= S209), N235 (= N232), A237 (≠ G234), H247 (= H244)
- binding guanine: A114 (= A111), G115 (= G112), E193 (= E190), G210 (= G207), M211 (= M208), T234 (= T231), N235 (= N232), T250 (= T247)
- binding phosphate ion: H61 (= H58), R81 (= R78), H83 (= H80), N112 (≠ C109), S212 (= S209)
P45563 Purine nucleoside phosphorylase 2; Inosine-guanosine phosphorylase; Purine nucleoside phosphorylase II; PNP II; Xanthosine phosphorylase; EC 2.4.2.1 from Escherichia coli (strain K12) (see paper)
52% identity, 91% coverage: 15:266/277 of query aligns to 22:273/277 of P45563
- H65 (= H58) binding
- RGH 85:87 (≠ RVH 78:80) binding
- A117 (= A110) binding
- Y191 (= Y184) mutation to L: No detectable activity with xanthosine as substrate, but largely retains its activity against other substrates, namely inosine and guanosine, although with altered affinities, higher and lower respectively, and clearly reduced maximal velocities for both.
- E197 (= E190) binding
- S216 (= S209) binding
- N239 (= N232) binding ; mutation to D: Catalyzes the phosphorolysis of adenosine with moderate efficiency, and essentially has lost all activity against the 6-oxo-purine substrates xanthosine, inosine and guanosine.
8swuA Structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate (see paper)
45% identity, 96% coverage: 5:269/277 of query aligns to 9:269/269 of 8swuA
- binding 1,4-dideoxy-4-aza-1-(s)-(9-deazahypoxanthin-9-yl)-d-ribitol: Y82 (= Y82), A110 (= A110), A111 (= A111), G112 (= G112), Y189 (≠ F189), E190 (= E190), M208 (= M208), N232 (= N232), H244 (= H244), V247 (≠ T247)
P46354 Purine nucleoside phosphorylase 1; PNP 1; Inosine phosphorylase; Inosine-guanosine phosphorylase; Purine nucleoside phosphorylase I; PNP I; Pu-NPase I; EC 2.4.2.1 from Bacillus subtilis (strain 168) (see paper)
49% identity, 95% coverage: 5:266/277 of query aligns to 7:260/271 of P46354
- S28 (= S27) modified: Phosphoserine
7zsoA Human purine nucleoside phosphorylase in complex with js-554 (see paper)
47% identity, 94% coverage: 5:263/277 of query aligns to 9:274/285 of 7zsoA
- binding [(~{E})-2-[2-[(4-oxidanylidene-3,5-dihydropyrrolo[3,2-d]pyrimidin-7-yl)sulfanyl]-5-[2,3,4,5,6-pentakis(fluoranyl)phenoxy]phenyl]ethenyl]phosphonic acid: S31 (= S27), R82 (= R78), H84 (= H80), N113 (≠ C109), A114 (= A110), A115 (= A111), G116 (= G112), F198 (= F189), E199 (= E190), V215 (= V206), M217 (= M208), S218 (= S209), T240 (= T231), N241 (= N232), V258 (≠ T247), L259 (= L248)
P00491 Purine nucleoside phosphorylase; PNP; Inosine phosphorylase; Inosine-guanosine phosphorylase; EC 2.4.2.1 from Homo sapiens (Human) (see 8 papers)
47% identity, 94% coverage: 5:263/277 of query aligns to 11:276/289 of P00491
- S33 (= S27) binding
- G51 (= G45) to S: in dbSNP:rs1049564
- H64 (= H58) mutation to W: Reduces catalytic activity towards inosine.
- RFH 84:86 (≠ RVH 78:80) binding
- Y88 (= Y82) binding
- A116 (= A110) binding
- E201 (= E190) binding ; mutation E->A,Q: Severe loss of catalytic activity.
- M219 (= M208) binding
- S220 (= S209) binding
- N243 (= N232) Important for substrate specificity; binding ; mutation to A: Reduces catalytic activity.; mutation to D: Reduces catalytic activity towards inosine, hypoxanthine, guanosine and guanine. Increases catalytic activity towards adenosine and adenine.
- H257 (= H244) binding ; mutation to W: Reduces catalytic activity towards inosine.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
7zsmA Human purine nucleoside phosphorylase in complex with js-375 (see paper)
47% identity, 94% coverage: 5:263/277 of query aligns to 9:274/282 of 7zsmA
- binding [(~{E})-2-[4-methoxy-2-[(4-oxidanylidene-3,5-dihydropyrrolo[3,2-d]pyrimidin-7-yl)sulfanyl]phenyl]ethenyl]phosphonic acid: R82 (= R78), H84 (= H80), N113 (≠ C109), A114 (= A110), A115 (= A111), G116 (= G112), F198 (= F189), E199 (= E190), V215 (= V206), G216 (= G207), S218 (= S209), T240 (= T231), N241 (= N232)
7zspA Human purine nucleoside phosphorylase in complex with js-555 (see paper)
47% identity, 94% coverage: 5:263/277 of query aligns to 8:273/281 of 7zspA
- binding [(~{E})-2-[2-[(4-oxidanylidene-3,5-dihydropyrrolo[3,2-d]pyrimidin-7-yl)sulfanyl]-6-[2,3,4,5,6-pentakis(fluoranyl)phenoxy]phenyl]ethenyl]phosphonic acid: S30 (= S27), N112 (≠ C109), A113 (= A110), A114 (= A111), G115 (= G112), F197 (= F189), E198 (= E190), V214 (= V206), M216 (= M208), S217 (= S209), N240 (= N232), L258 (= L248)
- binding 6-tungstotellurate(VI): N52 (≠ G49), F53 (= F50), P54 (= P51), R55 (≠ L52), W91 (≠ D88), K92 (≠ A89), R145 (≠ T139), R204 (= R196), D245 (≠ L237), Y246 (≠ G238), E247 (≠ D239)
7zsnA Human purine nucleoside phosphorylase in complex with js-379 (see paper)
47% identity, 94% coverage: 5:263/277 of query aligns to 8:273/282 of 7zsnA
- binding [(~{E})-2-[5-bromanyl-2-[(4-oxidanylidene-3,5-dihydropyrrolo[3,2-d]pyrimidin-7-yl)sulfanyl]phenyl]ethenyl]phosphonic acid: G29 (= G26), S30 (= S27), R81 (= R78), H83 (= H80), N112 (≠ C109), A113 (= A110), G115 (= G112), F197 (= F189), E198 (= E190), V214 (= V206), M216 (= M208), S217 (= S209), N240 (= N232), V257 (≠ T247)
- binding 6-tungstotellurate(VI): N52 (≠ G49), F53 (= F50), R55 (≠ L52), K92 (≠ A89), R204 (= R196), D245 (≠ L237), Y246 (≠ G238), E247 (≠ D239)
1rszA Structure of human purine nucleoside phosphorylase in complex with dadme-immucillin-h and sulfate
47% identity, 94% coverage: 5:263/277 of query aligns to 9:274/282 of 1rszA
- active site: S31 (= S27), H62 (= H58), H84 (= H80), Y86 (= Y82), E87 (= E83), A114 (= A110), M217 (= M208), S218 (= S209), N241 (= N232), V243 (≠ G234), H255 (= H244)
- binding 7-[[(3R,4R)-3-(hydroxymethyl)-4-oxidanyl-pyrrolidin-1-ium-1-yl]methyl]-3,5-dihydropyrrolo[3,2-d]pyrimidin-4-one: Y86 (= Y82), A114 (= A110), A115 (= A111), G116 (= G112), F198 (= F189), E199 (= E190), V215 (= V206), M217 (= M208), N241 (= N232), H255 (= H244), V258 (≠ T247)
3inyA Crystal structure of human purine nucleoside phosphorylase in complex with 7-deazaguanine (see paper)
47% identity, 94% coverage: 5:263/277 of query aligns to 10:275/288 of 3inyA
- active site: S32 (= S27), H63 (= H58), H85 (= H80), Y87 (= Y82), E88 (= E83), A115 (= A110), M218 (= M208), S219 (= S209), N242 (= N232), V244 (≠ G234), H256 (= H244)
- binding 7-deazaguanine: A115 (= A110), A116 (= A111), G117 (= G112), F199 (= F189), E200 (= E190), V216 (= V206), T241 (= T231), N242 (= N232)
3d1vA Crystal structure of human pnp complexed with 2-mercapto(3h) quinazolinone (see paper)
47% identity, 94% coverage: 5:263/277 of query aligns to 10:275/288 of 3d1vA
- active site: S32 (= S27), H63 (= H58), H85 (= H80), Y87 (= Y82), E88 (= E83), A115 (= A110), M218 (= M208), S219 (= S209), N242 (= N232), V244 (≠ G234), H256 (= H244)
- binding 2-mercapto(3H)quinazolinone: A115 (= A110), G117 (= G112), F199 (= F189), E200 (= E190), V216 (= V206), T241 (= T231), N242 (= N232)
1yryE Crystal structure of human pnp complexed with mesg (see paper)
47% identity, 94% coverage: 5:263/277 of query aligns to 10:275/288 of 1yryE
- active site: S32 (= S27), H63 (= H58), H85 (= H80), Y87 (= Y82), E88 (= E83), A115 (= A110), M218 (= M208), S219 (= S209), N242 (= N232), H256 (= H244)
- binding 7-methyl-6-thio-guanosine: Y87 (= Y82), A115 (= A110), A116 (= A111), G117 (= G112), E200 (= E190), V216 (= V206), G217 (= G207), M218 (= M208), T241 (= T231), N242 (= N232), H256 (= H244)
1v45E Crystal structure of human pnp complexed with 3-deoxyguanosine (see paper)
47% identity, 94% coverage: 5:263/277 of query aligns to 10:275/288 of 1v45E
- active site: S32 (= S27), H63 (= H58), Y87 (= Y82), A115 (= A110), M218 (= M208), S219 (= S209), H256 (= H244)
- binding 9-(3-deoxy-beta-d-ribofuranosyl)guanine: A115 (= A110), G117 (= G112), F199 (= F189), E200 (= E190), V216 (= V206), M218 (= M208), N242 (= N232), H256 (= H244)
1v41E Crystal structure of human pnp complexed with 8-azaguanine (see paper)
47% identity, 94% coverage: 5:263/277 of query aligns to 10:275/288 of 1v41E
- active site: S32 (= S27), H63 (= H58), Y87 (= Y82), A115 (= A110), M218 (= M208), S219 (= S209), H256 (= H244)
- binding 5-amino-1h-[1,2,3]triazolo[4,5-d]pyrimidin-7-ol: A115 (= A110), A116 (= A111), G117 (= G112), F199 (= F189), E200 (= E190), V216 (= V206), M218 (= M208), T241 (= T231), N242 (= N232)
1v3qE Structure of human pnp complexed with ddi (see paper)
47% identity, 94% coverage: 5:263/277 of query aligns to 10:275/288 of 1v3qE
- active site: S32 (= S27), H63 (= H58), Y87 (= Y82), A115 (= A110), M218 (= M208), S219 (= S209), H256 (= H244)
- binding 9-[(2r,5r)-5-(hydroxymethyl)tetrahydrofuran-2-yl]-1,9-dihydro-6h-purin-6-one: G117 (= G112), F199 (= F189), E200 (= E190), V216 (= V206), M218 (= M208), N242 (= N232), H256 (= H244)
1v2hE Crystal structure of human pnp complexed with guanine (see paper)
47% identity, 94% coverage: 5:263/277 of query aligns to 10:275/288 of 1v2hE
- active site: S32 (= S27), H63 (= H58), Y87 (= Y82), A115 (= A110), M218 (= M208), S219 (= S209), H256 (= H244)
- binding guanine: A116 (= A111), G117 (= G112), E200 (= E190), M218 (= M208), T241 (= T231), N242 (= N232)
1rfgE Crystal structure of human purine nucleoside phosphorylase complexed with guanosine (see paper)
47% identity, 94% coverage: 5:263/277 of query aligns to 10:275/288 of 1rfgE
- active site: S32 (= S27), H63 (= H58), Y87 (= Y82), A115 (= A110), M218 (= M208), S219 (= S209), H256 (= H244)
- binding guanosine: A115 (= A110), G117 (= G112), F199 (= F189), E200 (= E190), V216 (= V206), M218 (= M208), T241 (= T231), N242 (= N232), H256 (= H244)
Query Sequence
>AZOBR_RS06645 FitnessBrowser__azobra:AZOBR_RS06645
MTAARAAAEILHRVPGFRPRVGIVLGSGLGGVADRIEGATVMPYGDLPGFPLPSVEGHMG
RLVLGHLGGQPVACMQGRVHAYEGNGFDALKTAVRALKLAGCDTLVLTCAAGSLRVEVGP
GRLMAISDHINMLGANPLTGPNEDSFGPRFPSMTDAWDPALRALMRRRALELNIDLVEGV
YAAYPGPSFETPAEVRMLKVLGADAVGMSTVPECIVARHCGLRVVGCAVITNLGVGLGDG
PVDHDQTLRAASAAASDLERLLTGFLDGLNIDEGRRS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory