SitesBLAST
Comparing AZOBR_RS06795 FitnessBrowser__azobra:AZOBR_RS06795 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
45% identity, 96% coverage: 11:327/331 of query aligns to 6:317/319 of A4F2N8
- K53 (= K58) mutation to A: Loss of enzymatic activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
39% identity, 96% coverage: 11:328/331 of query aligns to 5:317/318 of 1wtcA
- active site: K52 (= K58), S77 (= S83), E203 (= E213), G207 (≠ F217), D209 (= D219), G231 (≠ A242), I302 (≠ L313), S303 (= S314)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ V26), K47 (≠ R53), M48 (≠ S54), A109 (= A115), A110 (≠ N116), Y114 (= Y120)
- binding magnesium ion: E203 (= E213), G207 (≠ F217), D209 (= D219)
- binding pyridoxal-5'-phosphate: F51 (= F57), K52 (= K58), N79 (= N85), G178 (≠ S188), G179 (= G189), G180 (= G190), G181 (= G191), G231 (≠ A242), E276 (= E287), T278 (≠ G289), S303 (= S314)
1v71A Crystal structure of s.Pombe serine racemase
39% identity, 96% coverage: 11:328/331 of query aligns to 5:317/318 of 1v71A
- active site: K52 (= K58), S77 (= S83), E203 (= E213), G207 (≠ F217), D209 (= D219), G231 (≠ A242), I302 (≠ L313), S303 (= S314)
- binding magnesium ion: E203 (= E213), G207 (≠ F217), D209 (= D219)
- binding pyridoxal-5'-phosphate: F51 (= F57), K52 (= K58), N79 (= N85), G178 (≠ S188), G179 (= G189), G180 (= G190), G181 (= G191), G231 (≠ A242), E276 (= E287), T278 (≠ G289), S303 (= S314), G304 (= G315)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
39% identity, 96% coverage: 11:328/331 of query aligns to 6:318/319 of 2zr8A
- active site: K53 (= K58), S78 (= S83), E204 (= E213), G208 (≠ F217), D210 (= D219), G232 (≠ A242), I303 (≠ L313), S304 (= S314)
- binding magnesium ion: E204 (= E213), G208 (≠ F217), D210 (= D219)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F57), K53 (= K58), S77 (= S82), S78 (= S83), N80 (= N85), H81 (= H86), P147 (= P152), G179 (≠ S188), G180 (= G189), G181 (= G190), G182 (= G191), G232 (≠ A242), E277 (= E287), T279 (≠ G289), S304 (= S314)
- binding serine: S78 (= S83), R129 (= R134), D231 (= D241), G232 (≠ A242), A233 (≠ L243), Q234 (≠ L244), T235 (= T245)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
39% identity, 96% coverage: 11:328/331 of query aligns to 6:318/319 of 2zpuA
- active site: K53 (= K58), S78 (= S83), E204 (= E213), G208 (≠ F217), D210 (= D219), G232 (≠ A242), I303 (≠ L313), S304 (= S314)
- binding magnesium ion: E204 (= E213), G208 (≠ F217), D210 (= D219)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F57), K53 (= K58), S77 (= S82), S78 (= S83), N80 (= N85), H81 (= H86), P147 (= P152), G179 (≠ S188), G180 (= G189), G181 (= G190), G182 (= G191), G232 (≠ A242), E277 (= E287), T279 (≠ G289), S304 (= S314)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
39% identity, 96% coverage: 11:328/331 of query aligns to 10:322/323 of O59791
- S82 (= S83) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
40% identity, 98% coverage: 4:327/331 of query aligns to 14:336/339 of Q7XSN8
- E219 (= E213) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (= D219) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
35% identity, 95% coverage: 6:319/331 of query aligns to 1:315/323 of 7nbfAAA
- active site: K53 (= K58), S81 (= S83), E207 (= E213), A211 (≠ F217), D213 (= D219), G236 (≠ A242), L309 (= L313), S310 (= S314)
- binding calcium ion: E207 (= E213), A211 (≠ F217), D213 (= D219)
- binding magnesium ion: D3 (≠ A8), N244 (≠ L251)
- binding pyridoxal-5'-phosphate: F52 (= F57), K53 (= K58), N83 (= N85), G182 (≠ S188), G183 (= G189), G184 (= G190), G185 (= G191), M186 (≠ L192), G236 (≠ A242), V237 (≠ L243), T282 (≠ G289), S310 (= S314), G311 (= G315)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ V26), L22 (≠ R27), T23 (= T28), P24 (= P29), L26 (= L31), T27 (≠ E32), F46 (≠ L51)
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
35% identity, 95% coverage: 6:319/331 of query aligns to 1:315/323 of 7nbdAAA
- active site: K53 (= K58), S81 (= S83), E207 (= E213), A211 (≠ F217), D213 (= D219), G236 (≠ A242), L309 (= L313), S310 (= S314)
- binding calcium ion: E207 (= E213), A211 (≠ F217), D213 (= D219)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ F279), L278 (≠ V285), V314 (= V318)
- binding magnesium ion: D3 (≠ A8), N244 (≠ L251)
- binding pyridoxal-5'-phosphate: F52 (= F57), K53 (= K58), N83 (= N85), G182 (≠ S188), G183 (= G189), G184 (= G190), G185 (= G191), M186 (≠ L192), G236 (≠ A242), V237 (≠ L243), E280 (= E287), T282 (≠ G289), S310 (= S314), G311 (= G315)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
35% identity, 95% coverage: 6:319/331 of query aligns to 1:315/323 of 7nbcCCC
- active site: K53 (= K58), S81 (= S83), E207 (= E213), A211 (≠ F217), D213 (= D219), G236 (≠ A242), L309 (= L313), S310 (= S314)
- binding biphenyl-4-ylacetic acid: T78 (≠ A80), H79 (≠ W81), H84 (= H86), V148 (= V150), H149 (≠ P151), P150 (= P152)
- binding calcium ion: E207 (= E213), A211 (≠ F217), D213 (= D219)
- binding pyridoxal-5'-phosphate: F52 (= F57), K53 (= K58), N83 (= N85), G182 (≠ S188), G183 (= G189), G184 (= G190), G185 (= G191), M186 (≠ L192), G236 (≠ A242), V237 (≠ L243), T282 (≠ G289), S310 (= S314), G311 (= G315)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
35% identity, 95% coverage: 6:319/331 of query aligns to 1:315/323 of 7nbcAAA
- active site: K53 (= K58), S81 (= S83), E207 (= E213), A211 (≠ F217), D213 (= D219), G236 (≠ A242), L309 (= L313), S310 (= S314)
- binding calcium ion: E207 (= E213), A211 (≠ F217), D213 (= D219)
- binding magnesium ion: D3 (≠ A8), N244 (≠ L251)
- binding pyridoxal-5'-phosphate: F52 (= F57), K53 (= K58), N83 (= N85), G182 (≠ S188), G183 (= G189), G184 (= G190), G185 (= G191), M186 (≠ L192), G236 (≠ A242), V237 (≠ L243), T282 (≠ G289), S310 (= S314), G311 (= G315)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
35% identity, 95% coverage: 6:319/331 of query aligns to 1:315/320 of 7nbhAAA
- active site: K53 (= K58), S81 (= S83), E207 (= E213), A211 (≠ F217), D213 (= D219), G236 (≠ A242), L309 (= L313), S310 (= S314)
- binding calcium ion: E207 (= E213), A211 (≠ F217), D213 (= D219)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (= S83), G85 (≠ A87), Q86 (= Q88), K111 (= K113), I115 (≠ T117), Y118 (= Y120), D235 (= D241), P281 (= P288), N313 (= N317), V314 (= V318), D315 (= D319)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
35% identity, 95% coverage: 6:319/331 of query aligns to 1:315/322 of 7nbgAAA
- active site: K53 (= K58), S81 (= S83), E207 (= E213), A211 (≠ F217), D213 (= D219), G236 (≠ A242), L309 (= L313), S310 (= S314)
- binding calcium ion: E207 (= E213), A211 (≠ F217), D213 (= D219)
- binding pyridoxal-5'-phosphate: F52 (= F57), K53 (= K58), N83 (= N85), G182 (≠ S188), G183 (= G189), G184 (= G190), G185 (= G191), M186 (≠ L192), G236 (≠ A242), V237 (≠ L243), T282 (≠ G289), S310 (= S314), G311 (= G315)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (= S83), G85 (≠ A87), Q86 (= Q88), I101 (= I103), K111 (= K113), I115 (≠ T117), Y118 (= Y120)
5cvcA Structure of maize serine racemase (see paper)
40% identity, 95% coverage: 14:327/331 of query aligns to 8:320/329 of 5cvcA
- active site: K52 (= K58), S77 (= S83), E203 (= E213), A207 (≠ F217), D209 (= D219), G231 (≠ A242), V306 (≠ L313), S307 (= S314)
- binding magnesium ion: E203 (= E213), A207 (≠ F217), D209 (= D219)
- binding pyridoxal-5'-phosphate: F51 (= F57), K52 (= K58), N79 (= N85), S178 (= S188), G179 (= G189), G180 (= G190), G181 (= G191), L232 (= L243), E275 (= E287), S307 (= S314), G308 (= G315)
6zspAAA serine racemase bound to atp and malonate. (see paper)
35% identity, 95% coverage: 6:319/331 of query aligns to 1:308/320 of 6zspAAA
- active site: K53 (= K58), S74 (= S83), E200 (= E213), A204 (≠ F217), D206 (= D219), G229 (≠ A242), L302 (= L313), S303 (= S314)
- binding adenosine-5'-triphosphate: S28 (≠ N33), S29 (≠ A34), I30 (≠ L35), K48 (≠ R53), T49 (≠ S54), Q79 (= Q88), Y111 (= Y120), E266 (≠ T280), R267 (≠ V281), K269 (= K283), N306 (= N317)
- binding magnesium ion: E200 (= E213), A204 (≠ F217), D206 (= D219)
- binding malonate ion: K53 (= K58), S73 (= S82), S74 (= S83), N76 (= N85), H77 (= H86), R125 (= R134), G229 (≠ A242), S232 (≠ T245)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
35% identity, 95% coverage: 6:319/331 of query aligns to 1:310/310 of 7nbgDDD
- active site: K53 (= K58), S76 (= S83), E202 (= E213), A206 (≠ F217), D208 (= D219), G231 (≠ A242), L304 (= L313), S305 (= S314)
- binding calcium ion: E202 (= E213), A206 (≠ F217), D208 (= D219)
- binding magnesium ion: D3 (≠ A8), N239 (≠ L251)
- binding ortho-xylene: S76 (= S83), Q81 (= Q88), I96 (= I103), Y113 (= Y120)
- binding pyridoxal-5'-phosphate: F52 (= F57), K53 (= K58), N78 (= N85), G177 (≠ S188), G178 (= G189), G179 (= G190), G180 (= G191), M181 (≠ L192), G231 (≠ A242), V232 (≠ L243), E275 (= E287), T277 (≠ G289), S305 (= S314), G306 (= G315)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
35% identity, 95% coverage: 6:319/331 of query aligns to 2:311/322 of 3l6bA
- active site: K54 (= K58), S77 (= S83), E203 (= E213), A207 (≠ F217), D209 (= D219), G232 (≠ A242), T278 (≠ G289), L305 (= L313), S306 (= S314)
- binding malonate ion: K54 (= K58), S76 (= S82), S77 (= S83), N79 (= N85), H80 (= H86), R128 (= R134), G232 (≠ A242)
- binding manganese (ii) ion: E203 (= E213), A207 (≠ F217), D209 (= D219)
- binding pyridoxal-5'-phosphate: F53 (= F57), K54 (= K58), N79 (= N85), G178 (≠ S188), G179 (= G189), G180 (= G190), G181 (= G191), M182 (≠ L192), V233 (≠ L243), E276 (= E287), T278 (≠ G289), S306 (= S314), G307 (= G315)
Q9QZX7 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Mus musculus (Mouse) (see paper)
36% identity, 96% coverage: 6:324/331 of query aligns to 4:323/339 of Q9QZX7
- C113 (≠ L112) modified: S-nitrosocysteine; mutation to S: Abolishes S-nitrosylation.
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
45% identity, 93% coverage: 12:319/331 of query aligns to 4:305/308 of 1ve5A
- active site: K50 (= K58), S56 (≠ N64), S72 (= S83), E200 (= E213), A204 (≠ F217), D206 (= D219), G229 (≠ A242), L299 (= L313), S300 (= S314)
- binding calcium ion: E200 (= E213), A204 (≠ F217), D206 (= D219)
- binding pyridoxal-5'-phosphate: F49 (= F57), K50 (= K58), N74 (= N85), G175 (≠ S188), G176 (= G189), G177 (= G190), G178 (= G191), E274 (= E287), T276 (≠ G289), S300 (= S314), G301 (= G315)
3hmkA Crystal structure of serine racemase (see paper)
35% identity, 96% coverage: 6:324/331 of query aligns to 2:321/321 of 3hmkA
- active site: K54 (= K58), S82 (= S83), E208 (= E213), A212 (≠ F217), D214 (= D219), G237 (≠ A242), T283 (≠ G289), L310 (= L313), S311 (= S314)
- binding manganese (ii) ion: E208 (= E213), A212 (≠ F217), D214 (= D219)
- binding pyridoxal-5'-phosphate: F53 (= F57), K54 (= K58), N84 (= N85), G183 (≠ S188), G184 (= G189), G185 (= G190), G186 (= G191), M187 (≠ L192), G237 (≠ A242), V238 (≠ L243), T283 (≠ G289), S311 (= S314), G312 (= G315)
Query Sequence
>AZOBR_RS06795 FitnessBrowser__azobra:AZOBR_RS06795
MPASNSFAIGHQDIVEAAARLDGFAVRTPLLENALLNERVGGRVLLKPEVLQRSGSFKFR
GAFNRLSQLTPEERRGGVVAWSSGNHAQGVAAAAALLGMPAVIVMPSDAPALKIANTRGY
GAEVVLYDRWTESREAIATAIAEERGAATVPPYDHPQIMAGQGTVGLEIAAQAQAIGAVP
DDVIAPCSGGGLMSGVATAVRHSFPDARLWAAEPAGFDDVARSLAAGERVENAAGQRSIC
DALLTPTPGALTFPVMKDLLSGSLAVTDAEVKAAMAYAFTVLKLVVEPGGAVGLAAVLTG
KLPAAGRTVAVVLSGGNVDAATFTDALALSS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory