Comparing AZOBR_RS06995 FitnessBrowser__azobra:AZOBR_RS06995 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q58761 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
27% identity, 95% coverage: 12:293/297 of query aligns to 8:284/284 of Q58761
Q97Z86 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
29% identity, 89% coverage: 20:283/297 of query aligns to 16:278/291 of Q97Z86
1u9zA Crystal structure of phosphoribosyl diphosphate synthase complexed with amp and ribose 5-phosphate (see paper)
26% identity, 95% coverage: 12:293/297 of query aligns to 8:274/274 of 1u9zA
4twbA Sulfolobus solfataricus ribose-phosphate pyrophosphokinase (see paper)
30% identity, 89% coverage: 20:283/297 of query aligns to 16:265/278 of 4twbA
3mbiA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
27% identity, 80% coverage: 17:254/297 of query aligns to 15:245/287 of 3mbiA
3mbiD Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
27% identity, 80% coverage: 17:254/297 of query aligns to 13:243/285 of 3mbiD
Q97CA5 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) (see paper)
27% identity, 80% coverage: 17:254/297 of query aligns to 13:243/286 of Q97CA5
3lpnA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). (see paper)
27% identity, 80% coverage: 17:254/297 of query aligns to 13:243/284 of 3lpnA
Sites not aligning to the query:
P0A717 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Escherichia coli (strain K12) (see 4 papers)
28% identity, 88% coverage: 17:277/297 of query aligns to 16:276/315 of P0A717
Sites not aligning to the query:
6asvC E. Coli prpp synthetase (see paper)
28% identity, 88% coverage: 17:277/297 of query aligns to 14:274/311 of 6asvC
4s2uA Crystal structure of the phosphorybosylpyrophosphate synthetase from e. Coli
29% identity, 88% coverage: 17:277/297 of query aligns to 15:275/308 of 4s2uA
7xmvA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a(amp/adp) filament bound with adp, amp and r5p (see paper)
28% identity, 88% coverage: 17:277/297 of query aligns to 14:268/307 of 7xmvA
7xmuA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a filament bound with adp, pi and r5p (see paper)
28% identity, 88% coverage: 17:277/297 of query aligns to 14:268/307 of 7xmuA
P9WKE3 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 84% coverage: 17:266/297 of query aligns to 24:275/326 of P9WKE3
Q63XL8 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Burkholderia pseudomallei (strain K96243) (see paper)
26% identity, 95% coverage: 1:283/297 of query aligns to 1:284/318 of Q63XL8
6nfeB Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
26% identity, 88% coverage: 17:277/297 of query aligns to 15:270/299 of 6nfeB
6nfeA Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
26% identity, 88% coverage: 17:277/297 of query aligns to 15:269/298 of 6nfeA
3dahC 2.3 a crystal structure of ribose-phosphate pyrophosphokinase from burkholderia pseudomallei (see paper)
25% identity, 90% coverage: 17:283/297 of query aligns to 14:272/300 of 3dahC
5t3oA Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus (see paper)
27% identity, 80% coverage: 17:254/297 of query aligns to 14:250/307 of 5t3oA
7pn0A Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus at r32 space group
27% identity, 80% coverage: 17:254/297 of query aligns to 15:251/312 of 7pn0A
>AZOBR_RS06995 FitnessBrowser__azobra:AZOBR_RS06995
MARYTGVYGFPESADGARRLAEALNVPCHIAELHRFPDGESLVRLPEAVERAVVYRSLDR
PNDKLVELTLAASVLRRHGATELCLVAPYMAYMRQDAVFRPGEPVSQAVVGDWLGRLFDR
FVCVEPHLHRTHTLDEVFVGRPSVCLSGAGAIAERLRRDGTAPDAVIVGPDEEAAPLVEV
VAGPLGLTALVGRKERRGDRDVTVTLPADAPLAGRPVVIVDDVISSGETIFSCARAARAA
GAASVRVFGVHALFDAAVAARFAAEGLGTPLSCDGVPHPSNDLPLARLIADALLAPC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory