Comparing AZOBR_RS07390 FitnessBrowser__azobra:AZOBR_RS07390 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mttA Ni- and zn-bound gloa2 at low resolution (see paper)
60% identity, 96% coverage: 4:129/131 of query aligns to 1:125/128 of 4mttA
P0AC81 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Escherichia coli (strain K12) (see paper)
59% identity, 98% coverage: 4:131/131 of query aligns to 1:127/135 of P0AC81
1fa6A Crystal structure of the co(ii)-bound glyoxalase i of escherichia coli (see paper)
59% identity, 96% coverage: 4:129/131 of query aligns to 1:125/128 of 1fa6A
1fa5A Crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli (see paper)
59% identity, 96% coverage: 4:129/131 of query aligns to 1:125/128 of 1fa5A
6bnnA Crystal structure of v278e-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 (see paper)
46% identity, 95% coverage: 5:129/131 of query aligns to 16:139/282 of 6bnnA
Sites not aligning to the query:
5d7zA Crystal structure of glyoxalase i from zea mays (see paper)
46% identity, 95% coverage: 5:129/131 of query aligns to 10:133/281 of 5d7zA
Sites not aligning to the query:
Q948T6 Lactoylglutathione lyase; Aldoketomutase; Allergen Glb33; Glyoxalase I; Glx I; Glyoxylase I 11; OsGLYI-11; OsGLYI11; Ketone-aldehyde mutase; Methylglyoxalase; PP33; S-D-lactoylglutathione methylglyoxal lyase; Allergen Ory s Glyoxalase I; EC 4.4.1.5 from Oryza sativa subsp. japonica (Rice) (see paper)
46% identity, 95% coverage: 5:129/131 of query aligns to 24:148/291 of Q948T6
Sites not aligning to the query:
6l0uB Crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor
40% identity, 96% coverage: 4:129/131 of query aligns to 23:169/177 of 6l0uB
4kykB Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
40% identity, 96% coverage: 4:129/131 of query aligns to 23:169/177 of 4kykB
4kyhA Crystal structure of mouse glyoxalase i complexed with zopolrestat (see paper)
40% identity, 96% coverage: 4:129/131 of query aligns to 25:171/177 of 4kyhA
3w0tA Human glyoxalase i with an n-hydroxypyridone derivative inhibitor
41% identity, 96% coverage: 4:129/131 of query aligns to 22:168/176 of 3w0tA
Sites not aligning to the query:
3vw9A Human glyoxalase i with an n-hydroxypyridone inhibitor (see paper)
41% identity, 96% coverage: 4:129/131 of query aligns to 22:168/176 of 3vw9A
Sites not aligning to the query:
1qipA Human glyoxalase i complexed with s-p- nitrobenzyloxycarbonylglutathione (see paper)
41% identity, 96% coverage: 4:129/131 of query aligns to 22:168/176 of 1qipA
Sites not aligning to the query:
1qinA Human glyoxalase i complexed with s-(n-hydroxy-n-p- iodophenylcarbamoyl) glutathione (see paper)
41% identity, 96% coverage: 4:129/131 of query aligns to 22:168/176 of 1qinA
Sites not aligning to the query:
1froA Human glyoxalase i with benzyl-glutathione inhibitor (see paper)
41% identity, 96% coverage: 4:129/131 of query aligns to 22:168/176 of 1froA
Sites not aligning to the query:
Q9CPU0 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Mus musculus (Mouse) (see paper)
40% identity, 96% coverage: 4:129/131 of query aligns to 30:176/184 of Q9CPU0
4kykA Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
40% identity, 96% coverage: 4:129/131 of query aligns to 25:171/179 of 4kykA
4x2aA Crystal structure of mouse glyoxalase i complexed with baicalein (see paper)
40% identity, 96% coverage: 4:129/131 of query aligns to 16:162/167 of 4x2aA
Sites not aligning to the query:
4pv5A Crystal structure of mouse glyoxalase i in complexed with 18-beta- glycyrrhetinic acid (see paper)
40% identity, 96% coverage: 4:129/131 of query aligns to 18:164/170 of 4pv5A
3w0uA Human glyoxalase i with an n-hydroxypyridone inhibitor
41% identity, 96% coverage: 4:129/131 of query aligns to 22:168/175 of 3w0uA
Sites not aligning to the query:
>AZOBR_RS07390 FitnessBrowser__azobra:AZOBR_RS07390
MSQFRLLHTMLRVYDLEKSLDFYTRLLGMKLLRRNDYEGGRFTLAFVGYGDEKDTAVLEL
THNWDQAEPYAIGTAYGHIALGVPDIYATCEQLAKEGVKIPRPPGPMKHGTTVIAFIEDP
DGYKVELIETK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory