Comparing AZOBR_RS07405 FitnessBrowser__azobra:AZOBR_RS07405 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
51% identity, 99% coverage: 1:199/202 of query aligns to 2:199/201 of 3m3mA
4hz2B Crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
46% identity, 95% coverage: 2:192/202 of query aligns to 2:191/206 of 4hz2B
4ecjA Crystal structure of glutathione s-transferase prk13972 (target efi- 501853) from pseudomonas aeruginosa pacs2 complexed with glutathione
34% identity, 95% coverage: 1:192/202 of query aligns to 2:191/204 of 4ecjA
6tahB Glutathione S-transferase
34% identity, 95% coverage: 1:192/202 of query aligns to 3:192/213 of 6tahB
Sites not aligning to the query:
4l8eA Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
31% identity, 89% coverage: 12:190/202 of query aligns to 10:192/203 of 4l8eA
Sites not aligning to the query:
1k0cA Ure2p in complex with s-p-nitrobenzylglutathione (see paper)
30% identity, 93% coverage: 4:190/202 of query aligns to 15:218/228 of 1k0cA
4mf6A Crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with two glutathione molecules bound per one protein subunit
34% identity, 82% coverage: 2:167/202 of query aligns to 27:196/240 of 4mf6A
1k0aA Ure2p in complex with s-hexylglutathione (see paper)
30% identity, 93% coverage: 4:190/202 of query aligns to 17:221/234 of 1k0aA
1jzrA Ure2p in complex with glutathione (see paper)
30% identity, 93% coverage: 4:190/202 of query aligns to 17:222/234 of 1jzrA
1k0cC Ure2p in complex with s-p-nitrobenzylglutathione (see paper)
30% identity, 93% coverage: 4:190/202 of query aligns to 17:226/239 of 1k0cC
4nhzH Crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., Target efi-507290, with one glutathione bound
32% identity, 93% coverage: 2:189/202 of query aligns to 33:229/246 of 4nhzH
5hfkA Crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. Sakai (ecs3186, target efi-507414) with bound glutathione
32% identity, 89% coverage: 12:190/202 of query aligns to 11:193/207 of 5hfkA
Sites not aligning to the query:
4ikhA Crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound
31% identity, 82% coverage: 2:166/202 of query aligns to 17:185/227 of 4ikhA
4zb8A Crystal structure of the glutathione transferase ure2p6 from phanerochaete chrysosporium in complex with oxidized glutathione. (see paper)
29% identity, 94% coverage: 1:190/202 of query aligns to 6:203/220 of 4zb8A
4zbdA Crystal structure of the glutathione transferase ure2p6 from phanerochaete chrysosporium in complex with glutathione reduced by x- ray irradiation at 100k (see paper)
29% identity, 94% coverage: 1:190/202 of query aligns to 5:202/219 of 4zbdA
P23202 Transcriptional regulator URE2; Disulfide reductase; Glutathione peroxidase; EC 1.8.4.-; EC 1.11.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
28% identity, 93% coverage: 4:190/202 of query aligns to 116:341/354 of P23202
1jzrC Ure2p in complex with glutathione (see paper)
28% identity, 93% coverage: 4:190/202 of query aligns to 17:242/255 of 1jzrC
4zb6D Crystal structure of glutathione transferase ure2p4 from phanerochaete chrysosporium in complex with oxidized glutathione. (see paper)
27% identity, 94% coverage: 1:190/202 of query aligns to 4:201/220 of 4zb6D
P77526 Disulfide-bond oxidoreductase YfcG; GSH-dependent disulfide-bond oxidoreductase YfcG; GST N1-1; GST-like protein YfcG; Organic hydroperoxidase; EC 1.8.4.-; EC 1.11.1.- from Escherichia coli (strain K12) (see 2 papers)
31% identity, 89% coverage: 12:190/202 of query aligns to 11:193/215 of P77526
Sites not aligning to the query:
3gx0A Crystal structure of gsh-dependent disulfide bond oxidoreductase (see paper)
31% identity, 89% coverage: 12:190/202 of query aligns to 11:193/204 of 3gx0A
Sites not aligning to the query:
>AZOBR_RS07405 FitnessBrowser__azobra:AZOBR_RS07405
MLRLYDNLSSGNGYKCRLLLHKLGIPYERIELDIDRAETRTPEFLARNPNGRIPTLQLED
GSHLPESNAILWYLAEGTPYLPDNREGRARVLQWMFFEQYSHEPNIATVRFWITHHVEMT
EERKLGLVTKRRLGHDALGVMDGHLAERRFFVGDRFSVADIALYAYTHVAEEGGFDLSGY
PAVRAWMERVAAEGPHIPITQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory