Other sequence analysis tools:
Find papers: PaperBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Comparing AZOBR_RS07475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree
Found no hits to proteins with known functional sites (download)
>AZOBR_RS07475
MADTYKVGGMTCGGCARSVTNAIGKLAPGAAVTVDLDAGTVAVEGGVAPETVKKAVEGAG
FDFGGQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory