Comparing AZOBR_RS07675 FitnessBrowser__azobra:AZOBR_RS07675 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
4h6dB Crystal structure of plp-soaked hmp synthase thi5 from s. Cerevisiae (see paper)
24% identity, 88% coverage: 35:331/339 of query aligns to 7:293/329 of 4h6dB
4h6dE Crystal structure of plp-soaked hmp synthase thi5 from s. Cerevisiae (see paper)
25% identity, 88% coverage: 35:331/339 of query aligns to 7:291/302 of 4h6dE
P43534 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI5; HMP-P synthase; Hydroxymethylpyrimidine phosphate synthase; Thiamine biosynthesis protein 5; Thiamine pyrimidine synthase; EC 2.-.-.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 88% coverage: 35:331/339 of query aligns to 10:302/340 of P43534
C4YMW2 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase; HMP-P synthase; Hydroxymethylpyrimidine phosphate synthase; Thiamine biosynthesis protein 5; Thiamine pyrimidine synthase; EC 2.-.-.- from Candida albicans (strain WO-1) (Yeast) (see paper)
25% identity, 63% coverage: 42:255/339 of query aligns to 17:231/339 of C4YMW2
Q5A3Y5 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase; HMP-P synthase; Hydroxymethylpyrimidine phosphate synthase; Thiamine biosynthesis protein 5; Thiamine pyrimidine synthase; EC 2.-.-.- from Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) (see paper)
25% identity, 63% coverage: 42:255/339 of query aligns to 17:231/339 of Q5A3Y5
Q5ZV75 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase; HMP-P synthase; Hydroxymethylpyrimidine phosphate synthase; Thiamine biosynthesis protein 5; Thiamine pyrimidine synthase; EC 2.-.-.- from Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) (see paper)
23% identity, 86% coverage: 42:334/339 of query aligns to 21:302/316 of Q5ZV75
8wm7C Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
28% identity, 71% coverage: 33:272/339 of query aligns to 277:527/658 of 8wm7C
Sites not aligning to the query:
6st0A Taurine abc transporter substrate binding protein taua from e. Coli in complex with n-(2-acetamido)-2-aminoethanesulfonic acid (see paper)
31% identity, 51% coverage: 45:218/339 of query aligns to 14:186/298 of 6st0A
Sites not aligning to the query:
6ssyA Taurine abc transporter substrate binding protein taua from e. Coli in complex with 2-aminoethylphosphonic acid (see paper)
31% identity, 51% coverage: 45:218/339 of query aligns to 14:186/298 of 6ssyA
Sites not aligning to the query:
>AZOBR_RS07675 FitnessBrowser__azobra:AZOBR_RS07675
MRMKSVIAAAAVVLAFGIGGANAQQVEKKDLKLAVGGKPLLYYLPLTVAERLGYFKEAGL
NVEINDFGGGAKSLQALVGGSADIVTGAFDHTVQMQAKGQPITAVALLGRYPGIVLAAVN
KAGTITSIKELKGKKIGVTAPGSSTNFMVNYLLTQHGMTPEDVSFIGVGGGPSAVAAVKR
GEIDAIANLDPVISQLEADGDVTTIADTRTEKGTLDTYGGPYPAAVLYTTPAFIKENPKT
TQALVDVFVRTLKWLDQAKTEDVLKVLPPEYFLGNQTLYAQAFEHSKPTYSPDGRFSQEG
AEAAYKVLKAFDKAVAATDIDLSKTYTNAYVEDSLKRIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory