Comparing AZOBR_RS07845 FitnessBrowser__azobra:AZOBR_RS07845 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9WYQ4 Glycerol dehydrogenase; GDH; GLDH; EC 1.1.1.6 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
67% identity, 100% coverage: 1:364/364 of query aligns to 1:363/364 of Q9WYQ4
1kq3A Crystal structure of a glycerol dehydrogenase (tm0423) from thermotoga maritima at 1.5 a resolution (see paper)
67% identity, 100% coverage: 1:364/364 of query aligns to 2:364/364 of 1kq3A
4mcaA Crystal structure of glycerol dehydrogenase from serratia to 1.9a
53% identity, 96% coverage: 8:355/364 of query aligns to 8:356/367 of 4mcaA
8gobA Crystal structure of glycerol dehydrogenase in the presence of NAD+ (see paper)
54% identity, 97% coverage: 8:360/364 of query aligns to 8:361/367 of 8gobA
8goaA Crystal structure of glycerol dehydrogenase in the absence of NAD+ (see paper)
54% identity, 97% coverage: 8:360/364 of query aligns to 8:361/367 of 8goaA
5zxlA Structure of glda from e.Coli (see paper)
54% identity, 97% coverage: 8:360/364 of query aligns to 8:361/367 of 5zxlA
P0A9S5 Glycerol dehydrogenase; GDH; GLDH; (R)-aminopropanol dehydrogenase; 1,2-propanediol dehydrogenase; D-1-amino-2-propanol oxidoreductase; EC 1.1.1.6; EC 1.1.1.75 from Escherichia coli (strain K12) (see paper)
54% identity, 97% coverage: 8:360/364 of query aligns to 8:361/367 of P0A9S5
5xn8A Structure of glycerol dehydrogenase crystallised as a contaminant
50% identity, 99% coverage: 1:360/364 of query aligns to 1:361/365 of 5xn8A
P32816 Glycerol dehydrogenase; GDH; GLDH; GlyDH; EC 1.1.1.6 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
49% identity, 98% coverage: 6:362/364 of query aligns to 8:365/370 of P32816
1jq5A Bacillus stearothermophilus glycerol dehydrogenase complex with NAD+ (see paper)
49% identity, 98% coverage: 6:362/364 of query aligns to 7:364/366 of 1jq5A
3uhjA Crystal structure of a probable glycerol dehydrogenase from sinorhizobium meliloti 1021
48% identity, 97% coverage: 8:359/364 of query aligns to 8:355/357 of 3uhjA
1jqaA Bacillus stearothermophilus glycerol dehydrogenase complex with glycerol (see paper)
49% identity, 98% coverage: 6:362/364 of query aligns to 6:359/361 of 1jqaA
1ta9B Crystal structure of glycerol dehydrogenase from schizosaccharomyces pombe
41% identity, 98% coverage: 8:362/364 of query aligns to 13:369/394 of 1ta9B
O13702 Glycerol dehydrogenase 1; GDH; GLDH; EC 1.1.1.6 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
41% identity, 98% coverage: 8:362/364 of query aligns to 69:425/450 of O13702
Q9YER2 Glycerol-1-phosphate dehydrogenase [NAD(P)+]; G1P dehydrogenase; G1PDH; Gro1PDH; Enantiomeric glycerophosphate synthase; sn-glycerol-1-phosphate dehydrogenase; EC 1.1.1.261 from Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) (see paper)
27% identity, 84% coverage: 7:313/364 of query aligns to 10:309/352 of Q9YER2
4rgqB Crystal structure of the methanocaldococcus jannaschii g1pdh with NADPH and dhap (see paper)
25% identity, 87% coverage: 8:325/364 of query aligns to 6:300/333 of 4rgqB
4rgvA Crystal structure of the methanocaldococcus jannaschii g1pdh (see paper)
26% identity, 70% coverage: 73:325/364 of query aligns to 53:295/328 of 4rgvA
5fb3F Structure of glycerophosphate dehydrogenase in complex with NADPH (see paper)
24% identity, 63% coverage: 83:310/364 of query aligns to 70:292/337 of 5fb3F
Sites not aligning to the query:
3ce9A Crystal structure of glycerol dehydrogenase (np_348253.1) from clostridium acetobutylicum at 2.37 a resolution
36% identity, 27% coverage: 85:182/364 of query aligns to 85:186/349 of 3ce9A
Sites not aligning to the query:
P31005 NAD-dependent methanol dehydrogenase; MDH; MEDH; Type 3 alcohol dehydrogenase; EC 1.1.1.244 from Bacillus methanolicus (see 3 papers)
24% identity, 97% coverage: 2:354/364 of query aligns to 1:380/381 of P31005
>AZOBR_RS07845 FitnessBrowser__azobra:AZOBR_RS07845
MITTAIFPARYVQGNGALDSLGEDLARLGKTVLAVTDSFVLKTLKGRLVEAAAGRVEMNI
QEFRGECSDEEIERLTGLARAMGADVVAGIGGGKALDTAKAVAHALNARTAIVPTLASTD
APCSALSVIYTPEGAFKRYLVLPRNPDLVLVDTGVVASAPVRFLVSGMGDALSTWFEAED
CRIKRGGNMTGRVGPMTAFALARLCYDTLLEYGVLAKSACEQGVVTPALERIVEANTLLS
GLGFESGGLAAAHAVHNGLTALEETHHCWHGEKVAFGTLTLLILTDRPPAVLDEVYGFCK
AVGLPTTLAEIGLAGVSDERLLLAAERACAEGETIHNEPHEITPQRVLAAMKAADAEGRR
RKGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory