SitesBLAST
Comparing AZOBR_RS07955 FitnessBrowser__azobra:AZOBR_RS07955 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
42% identity, 89% coverage: 1:270/302 of query aligns to 14:284/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (= I10), M24 (= M11), N43 (≠ D30), R44 (≠ I31), T45 (≠ N32), K48 (≠ P35), V77 (= V63), S78 (≠ P64), D82 (≠ H68), Q85 (≠ A71), V133 (= V119), F244 (= F230), K245 (≠ R231), H248 (≠ L234), K251 (= K237)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
42% identity, 89% coverage: 1:270/302 of query aligns to 14:281/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (= I10), M24 (= M11), N43 (≠ D30), R44 (≠ I31), T45 (≠ N32), K48 (≠ P35), M76 (= M62), V77 (= V63), S78 (≠ P64), D82 (≠ H68), Q85 (≠ A71), V133 (= V119), F241 (= F230), K242 (≠ R231), H245 (≠ L234), K248 (= K237)
- binding sulfate ion: T134 (≠ S120), G135 (= G121), K183 (= K169)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
31% identity, 93% coverage: 3:283/302 of query aligns to 6:289/294 of 5je8B
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
31% identity, 94% coverage: 1:284/302 of query aligns to 1:292/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), N10 (≠ I10), M11 (= M11), Y29 (= Y29), D30 (= D30), V31 (≠ I31), M63 (= M62), L64 (≠ V63), P65 (= P64), T95 (≠ S94), V120 (= V119), G122 (= G121), F238 (= F230), K245 (= K237)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
31% identity, 93% coverage: 3:284/302 of query aligns to 42:331/336 of P31937
- LP 103:104 (≠ VP 63:64) binding
- N108 (≠ H68) binding
- T134 (≠ S94) binding
- K284 (= K237) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
30% identity, 93% coverage: 3:284/302 of query aligns to 41:330/335 of P29266
- D68 (= D30) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K169) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q173) mutation to Q: Decrease in activity.
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
32% identity, 94% coverage: 3:287/302 of query aligns to 4:290/298 of P0A9V8
- QM 11:12 (≠ IM 10:11) binding
- D31 (= D30) binding
- L65 (≠ V63) binding
- T96 (≠ S94) binding
- G122 (≠ S120) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G121) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G122) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NN-YMS 174:178 (≠ NQIVVA 172:177) binding
- K240 (= K237) binding
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
32% identity, 94% coverage: 3:287/302 of query aligns to 3:289/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), Q10 (≠ I10), M11 (= M11), F29 (≠ Y29), D30 (= D30), V31 (≠ I31), M63 (= M62), L64 (≠ V63), V73 (≠ A72), S94 (= S93), T95 (≠ S94), R122 (≠ G121)
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
32% identity, 94% coverage: 3:287/302 of query aligns to 3:289/294 of 6smyA
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
32% identity, 94% coverage: 2:284/302 of query aligns to 3:286/287 of 3pduA
- binding glycerol: R242 (≠ N240), E246 (≠ S244), E246 (≠ S244), R250 (≠ A248)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), G10 (= G9), I11 (= I10), M12 (= M11), N31 (≠ D30), R32 (≠ I31), N33 (= N32), M64 (= M62), L65 (≠ V63), A66 (≠ P64), A70 (≠ H68), T96 (≠ S94), V121 (= V119), G123 (= G121), T124 (≠ G122), K171 (= K169), S231 (≠ G229), F232 (= F230), P233 (≠ R231), H236 (≠ L234), K239 (= K237)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
32% identity, 93% coverage: 4:284/302 of query aligns to 5:286/287 of 3pefA
- binding glycerol: D67 (= D65), G123 (= G121), K171 (= K169), N175 (≠ Q173), M178 (≠ V176), L203 (≠ R201), G207 (≠ M205), N213 (≠ S211), A217 (≠ E215), F232 (= F230), H236 (≠ L234), K239 (= K237), R242 (≠ N240), R269 (≠ A267)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G9), I11 (= I10), M12 (= M11), N31 (≠ D30), R32 (≠ I31), S33 (≠ N32), K36 (≠ A34), M64 (= M62), L65 (≠ V63), A66 (≠ P64), A70 (≠ H68), E73 (≠ A71), T96 (≠ S94), V121 (= V119), G123 (= G121), S124 (≠ G122), A231 (≠ G229), F232 (= F230), H236 (≠ L234), K239 (= K237)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
34% identity, 96% coverage: 2:291/302 of query aligns to 3:288/289 of 2cvzC
- active site: S117 (= S120), K165 (= K169), N168 (= N172), N169 (≠ Q173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), L9 (= L8), G10 (= G9), A11 (≠ I10), M12 (= M11), N30 (≠ V28), R31 (≠ Y29), T32 (≠ D30), C62 (≠ M62), L63 (≠ V63), P64 (= P64), E68 (≠ H68), E71 (≠ A71), S91 (= S94), V116 (= V119), F227 (= F230), K234 (= K237)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
34% identity, 96% coverage: 2:291/302 of query aligns to 2:287/288 of 1wp4A
- active site: S116 (= S120), K164 (= K169), N167 (= N172), N168 (≠ Q173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G7), L8 (= L8), G9 (= G9), A10 (≠ I10), M11 (= M11), N29 (≠ V28), R30 (≠ Y29), T31 (≠ D30), K34 (≠ P33), C61 (≠ M62), L62 (≠ V63), P63 (= P64), E67 (≠ H68), S90 (= S94), V115 (= V119), T225 (≠ G229), F226 (= F230), K233 (= K237)
- binding sulfate ion: S116 (= S120), G117 (= G121), G118 (= G122), K164 (= K169)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
36% identity, 79% coverage: 2:241/302 of query aligns to 3:250/298 of Q9I5I6
- P66 (= P64) binding
- T96 (≠ S94) binding ; mutation to A: Almost abolished activity.
- S122 (= S120) mutation to A: Strongly reduced activity.
- K171 (= K169) active site
- N175 (≠ Q173) mutation to A: Strongly reduced activity.
- W214 (≠ R212) mutation to A: Almost abolished activity.
- Y219 (≠ H217) mutation to A: Strongly reduced activity.
- K246 (= K237) binding ; mutation to A: Almost abolished activity.
- D247 (= D238) mutation to A: Almost abolished activity.
Sites not aligning to the query:
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
36% identity, 79% coverage: 2:241/302 of query aligns to 2:248/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), H10 (≠ I10), M11 (= M11), F29 (≠ Y29), D30 (= D30), L31 (vs. gap), M63 (= M62), L64 (≠ V63), P65 (= P64), T94 (≠ S94), V119 (= V119), G121 (= G121), F237 (= F230), K244 (= K237)
2uyyA Structure of the cytokine-like nuclear factor n-pac
29% identity, 93% coverage: 3:282/302 of query aligns to 9:289/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G9), L16 (≠ I10), M17 (= M11), N36 (≠ D30), R37 (≠ I31), T38 (≠ N32), V70 (= V63), S71 (≠ P64), A75 (≠ H68), T101 (≠ S94), F237 (= F230), Y238 (≠ R231), Y241 (≠ L234), K244 (= K237)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
29% identity, 93% coverage: 2:282/302 of query aligns to 269:550/553 of Q49A26
- 271:285 (vs. 4:18, 47% identical) binding
- T362 (≠ S94) binding
- M437 (≠ K169) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (= P228) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K237) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
36% identity, 79% coverage: 2:241/302 of query aligns to 3:249/295 of 3obbA
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
28% identity, 93% coverage: 2:282/302 of query aligns to 268:543/546 of Q922P9
- P489 (= P228) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
31% identity, 95% coverage: 2:288/302 of query aligns to 2:292/292 of 5y8iA
Query Sequence
>AZOBR_RS07955 FitnessBrowser__azobra:AZOBR_RS07955
MNVGFIGLGIMGRPMAGHLADAGHTLFVYDINPAPEDLLAKGATACGSSREVAQKADIVF
TMVPDTPHVQAALFGPNGVAEGLSAGKIVVDMSSISPIETKAFAQRINELGCDYLDAPVS
GGEVGAKAASLTIMVGGPDKAFETVKPLFEKMGKNITLVGGNGDGQTTKVANQIVVALTI
EAVGEALLFASKAGADPAKVRQALMGGFASSRILEVHGERMVKRTFDPGFRIELHQKDLN
LALSGARALGVSLPNTATCQELFNACAAQGGKAWDHSGMVRALELLANHEIGQNHRVTEP
AE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory