SitesBLAST
Comparing AZOBR_RS08350 FitnessBrowser__azobra:AZOBR_RS08350 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6a2fA Crystal structure of biosynthetic alanine racemase from pseudomonas aeruginosa (see paper)
40% identity, 94% coverage: 16:369/378 of query aligns to 5:356/358 of 6a2fA
- active site: K34 (= K45), R130 (= R144), H159 (= H173), R209 (= R223), Y254 (= Y265), S301 (= S312), D303 (= D314)
- binding acetate ion: Y254 (= Y265), R279 (= R290), L340 (≠ I353), Y342 (= Y355)
- binding d-lysine: Y254 (= Y265), Y273 (= Y284), S301 (= S312), M302 (= M313), D303 (= D314), M304 (≠ L315)
- binding malonate ion: K123 (≠ H137), R130 (= R144), L131 (= L145)
6g59A Structure of the alanine racemase from staphylococcus aureus in complex with an pyridoxal-6- phosphate derivative (see paper)
33% identity, 98% coverage: 3:371/378 of query aligns to 3:375/387 of 6g59A
- active site: K44 (= K45), R143 (= R144), H173 (= H173), R224 (= R223), Y270 (= Y265), C316 (≠ S312), D318 (= D314)
- binding (6-ethynyl-4-methanoyl-5-oxidanyl-pyridin-3-yl)methyl dihydrogen phosphate: K44 (= K45), Y48 (= Y49), L90 (= L92), H173 (= H173), S209 (= S208), R224 (= R223), G226 (= G225), I227 (≠ C226), Y359 (= Y355)
6g58A Structure of the alanine racemase from staphylococcus aureus in complex with a pyridoxal 5' phosphate-derivative (see paper)
33% identity, 97% coverage: 6:371/378 of query aligns to 1:370/382 of 6g58A
- active site: K39 (= K45), R138 (= R144), H168 (= H173), R219 (= R223), Y265 (= Y265), C311 (≠ S312), D313 (= D314)
- binding (6-but-3-ynyl-4-methyl-5-oxidanyl-pyridin-3-yl)methyl dihydrogen phosphate: K39 (= K45), Y43 (= Y49), L85 (= L92), K131 (≠ H137), R138 (= R144), H168 (= H173), S204 (= S208), R219 (= R223), G221 (= G225), I222 (≠ C226), Y354 (= Y355)
1rcqA The 1.45 a crystal structure of alanine racemase from a pathogenic bacterium, pseudomonas aeruginosa, contains both internal and external aldimine forms (see paper)
35% identity, 93% coverage: 19:369/378 of query aligns to 8:354/357 of 1rcqA
- active site: K33 (= K45), R129 (= R144), H158 (= H173), R208 (= R223), Y253 (= Y265), S300 (= S312), D302 (= D314)
- binding d-lysine: K33 (= K45), R129 (= R144), Y341 (= Y355)
- binding pyridoxal-5'-phosphate: V31 (= V43), K33 (= K45), Y37 (= Y49), H158 (= H173), N192 (= N207), S193 (= S208), R208 (= R223), G210 (= G225), I211 (≠ C226), Y341 (= Y355)
Q9HTQ2 Alanine racemase, catabolic; EC 5.1.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
34% identity, 93% coverage: 19:369/378 of query aligns to 8:354/357 of Q9HTQ2
- K33 (= K45) modified: N6-(pyridoxal phosphate)lysine
- K122 (≠ H137) modified: N6-carboxylysine
2rjhA Crystal structure of biosynthetic alaine racemase in d-cycloserine- bound form from escherichia coli (see paper)
33% identity, 94% coverage: 15:371/378 of query aligns to 4:359/359 of 2rjhA
- active site: K34 (= K45), R129 (= R144), H159 (= H173), R209 (= R223), Y255 (= Y265), A302 (≠ S312), D304 (= D314)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K34 (= K45), Y38 (= Y49), R129 (= R144), H159 (= H173), A193 (≠ N207), S194 (= S208), R209 (= R223), G211 (= G225), I212 (≠ C226), Y255 (= Y265), A302 (≠ S312), M303 (= M313), Y343 (= Y355)
P0A6B4 Alanine racemase, biosynthetic; EC 5.1.1.1 from Escherichia coli (strain K12) (see paper)
33% identity, 94% coverage: 15:371/378 of query aligns to 4:359/359 of P0A6B4
- K34 (= K45) modified: N6-(pyridoxal phosphate)lysine
- K122 (≠ H137) modified: N6-carboxylysine
- D164 (= D178) mutation to A: Slightly reduces affinity for D-Ala and L-Ala.; mutation to K: Reduces catalytic activity. Slightly reduces affinity for D-Ala and L-Ala.
- E165 (= E179) mutation to A: Slightly reduces affinity for D-Ala and L-Ala.; mutation to K: Reduces catalytic activity. Slightly reduces affinity for D-Ala and L-Ala.
- P219 (= P233) mutation to A: No effect on catalytic activity. No effect on affinity for D-Ala and L-Ala.
- E221 (vs. gap) mutation E->A,K,P: Slightly increases catalytic activity. Slightly increases affinity for D-Ala and L-Ala.
4xbjA Y274f alanine racemase from e. Coli inhibited by l-ala-p (see paper)
33% identity, 94% coverage: 15:371/378 of query aligns to 2:357/357 of 4xbjA
- active site: K32 (= K45), R127 (= R144), H157 (= H173), R207 (= R223), Y253 (= Y265), A300 (≠ S312), D302 (= D314)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: V30 (= V43), K32 (= K45), Y36 (= Y49), R127 (= R144), H157 (= H173), A191 (≠ N207), S192 (= S208), R207 (= R223), G209 (= G225), I210 (≠ C226), Y253 (= Y265), A300 (≠ S312), M301 (= M313), Y341 (= Y355)
5yycA Crystal structure of alanine racemase from bacillus pseudofirmus (of4) (see paper)
31% identity, 93% coverage: 19:371/378 of query aligns to 13:368/368 of 5yycA
- active site: K41 (= K45), R139 (= R144), H169 (= H173), R225 (= R223), Y269 (= Y265), C316 (≠ S312), D318 (= D314)
- binding pyridoxal-5'-phosphate: K41 (= K45), Y45 (= Y49), R139 (= R144), H169 (= H173), N209 (= N207), S210 (= S208), R225 (= R223), G227 (= G225), I228 (≠ C226), Y352 (= Y355)
3b8tA Crystal structure of escherichia coli alaine racemase mutant p219a (see paper)
33% identity, 94% coverage: 15:371/378 of query aligns to 4:359/359 of 3b8tA
- active site: K34 (= K45), R129 (= R144), H159 (= H173), R209 (= R223), Y255 (= Y265), A302 (≠ S312), D304 (= D314)
- binding pyridoxal-5'-phosphate: V32 (= V43), K34 (= K45), Y38 (= Y49), L78 (≠ S91), H159 (= H173), A193 (≠ N207), S194 (= S208), R209 (= R223), G211 (= G225), I212 (≠ C226), Y343 (= Y355)
P9WQA9 Alanine racemase; EC 5.1.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 93% coverage: 19:371/378 of query aligns to 16:380/384 of P9WQA9
- K42 (= K45) modified: N6-(pyridoxal phosphate)lysine
6sczA Mycobacterium tuberculosis alanine racemase inhibited by dcs (see paper)
34% identity, 93% coverage: 19:371/378 of query aligns to 8:372/373 of 6sczA
- active site: K34 (= K45), R132 (= R144), H164 (= H173), R220 (= R223), Y263 (= Y265), C310 (≠ S312), D312 (= D314)
- binding (~{E})-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylidene-[(4~{R})-3-oxidanylidene-1,2-oxazolidin-4-yl]azanium: K34 (= K45), Y38 (= Y49), W80 (≠ R88), H164 (= H173), S205 (= S208), R220 (= R223), G222 (= G225), I223 (≠ C226), Y356 (= Y355)
- binding [2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methyl-(3-oxidanyl-1,2-oxazol-4-yl)azanium: Y38 (= Y49), W80 (≠ R88), H164 (= H173), N204 (= N207), S205 (= S208), R220 (= R223), G222 (= G225), I223 (≠ C226), Y263 (= Y265), Y282 (= Y284), M311 (= M313), Y356 (= Y355)
- binding polyethylene glycol: D172 (= D180), A210 (≠ H213), P212 (≠ T215)
1xfcA The 1.9 a crystal structure of alanine racemase from mycobacterium tuberculosis contains a conserved entryway into the active site (see paper)
33% identity, 93% coverage: 19:371/378 of query aligns to 6:365/366 of 1xfcA
- active site: K32 (= K45), R130 (= R144), H162 (= H173), R213 (= R223), C303 (≠ S312), D305 (= D314)
- binding pyridoxal-5'-phosphate: K32 (= K45), Y36 (= Y49), W78 (≠ R88), H162 (= H173), S198 (= S208), R213 (= R223), G215 (= G225), I216 (≠ C226), Y349 (= Y355)
4y2wA Crystal structure of a thermostable alanine racemase from thermoanaerobacter tengcongensis mb4 (see paper)
28% identity, 92% coverage: 21:369/378 of query aligns to 15:374/388 of 4y2wA
- active site: K40 (= K45), R138 (= R144), H168 (= H173), R224 (= R223), Y268 (= Y265), C315 (≠ S312), D317 (= D314)
- binding alanine: Y268 (= Y265), Y287 (= Y284), C315 (≠ S312), M316 (= M313)
- binding phosphate ion: N208 (= N207), A209 (≠ S208), I227 (≠ C226)
1sftA Alanine racemase (see paper)
34% identity, 93% coverage: 19:369/378 of query aligns to 11:367/382 of 1sftA
- active site: K38 (= K45), R135 (= R144), H165 (= H173), R218 (= R223), Y264 (= Y265), C310 (≠ S312), D312 (= D314)
- binding pyridoxal-5'-phosphate: K38 (= K45), Y42 (= Y49), L84 (= L92), R135 (= R144), H165 (= H173), S203 (= S208), R218 (= R223), G220 (= G225), I221 (≠ C226), Y353 (= Y355)
1ftxA Crystal structure of alanine racemase in complex with d-alanine phosphonate
34% identity, 93% coverage: 19:369/378 of query aligns to 11:367/380 of 1ftxA
- active site: K38 (= K45), R135 (= R144), H165 (= H173), R218 (= R223), Y264 (= Y265), C310 (≠ S312), D312 (= D314)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: K38 (= K45), Y42 (= Y49), R135 (= R144), H165 (= H173), N202 (= N207), S203 (= S208), R218 (= R223), G220 (= G225), I221 (≠ C226), Y264 (= Y265), C310 (≠ S312), M311 (= M313), Y353 (= Y355)
5fagA Alanine racemase from streptomyces coelicolor a3(2) with bound propionate inhibitor (see paper)
34% identity, 93% coverage: 19:369/378 of query aligns to 19:387/390 of 5fagA
- active site: I19 (= I19), K45 (= K45), A46 (= A46), R147 (= R144), H180 (= H173), R236 (= R223), Y282 (= Y265), A329 (≠ S312), D331 (= D314)
- binding pyridoxal-5'-phosphate: K45 (= K45), Y49 (= Y49), W95 (≠ L92), W178 (≠ M171), H180 (= H173), N220 (= N207), S221 (= S208), R236 (= R223), G238 (= G225), I239 (≠ C226), Y373 (= Y355)
5fajA Alanine racemase from streptomyces coelicolor a3(2) in complex with d- cycloserine (see paper)
34% identity, 93% coverage: 19:369/378 of query aligns to 14:382/385 of 5fajA
- active site: I14 (= I19), K40 (= K45), A41 (= A46), R142 (= R144), H175 (= H173), R231 (= R223), Y277 (= Y265), A324 (≠ S312), D326 (= D314)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K40 (= K45), Y44 (= Y49), W90 (≠ L92), W173 (≠ M171), H175 (= H173), N215 (= N207), S216 (= S208), R231 (= R223), P232 (= P224), G233 (= G225), I234 (≠ C226), Y277 (= Y265), Y296 (= Y284), M325 (= M313), Y368 (= Y355)
1l6gA Alanine racemase bound with n-(5'-phosphopyridoxyl)-d-alanine (see paper)
34% identity, 93% coverage: 19:369/378 of query aligns to 11:367/382 of 1l6gA
- active site: K38 (= K45), R135 (= R144), H165 (= H173), R218 (= R223), Y264 (= Y265), C310 (≠ S312), D312 (= D314)
- binding n-(5'-phosphopyridoxyl)-d-alanine: K38 (= K45), Y42 (= Y49), R135 (= R144), H165 (= H173), S203 (= S208), R218 (= R223), G220 (= G225), I221 (≠ C226), Y264 (= Y265), C310 (≠ S312), M311 (= M313), Y353 (= Y355)
1l6fA Alanine racemase bound with n-(5'-phosphopyridoxyl)-l-alanine (see paper)
34% identity, 93% coverage: 19:369/378 of query aligns to 11:367/382 of 1l6fA
- active site: K38 (= K45), R135 (= R144), H165 (= H173), R218 (= R223), Y264 (= Y265), C310 (≠ S312), D312 (= D314)
- binding alanyl-pyridoxal-5'-phosphate: K38 (= K45), Y42 (= Y49), R135 (= R144), H165 (= H173), N202 (= N207), S203 (= S208), R218 (= R223), G220 (= G225), I221 (≠ C226), Y264 (= Y265), C310 (≠ S312), M311 (= M313), Y353 (= Y355)
Query Sequence
>AZOBR_RS08350 FitnessBrowser__azobra:AZOBR_RS08350
MTSAPLSDPLARAGAVLTIDLGAVVANWTQLRDRVAPAECAAVVKANAYGLGVGRVVPAL
AAAGCRTFVVAQFEEALAVRAVAPTNARVLSLGGLPAGTAPDFTAQRILPVLNHLGDIAA
WQAHARAQGTALPAVVHIDTGMNRLGLGPDELDTLVGDLSRLEGVDVRVWMTHLACADED
SVMNSQQLGRFRSAIGRLPAAEASFANSSGIFHGTAFHFDLVRPGCALYGVNPTPAAENP
MRGTIRLDARLLQVRNVDSPMTVGYGATHRVAARGKIATIAVGYADGYLRSLSGRGHVFV
NGVAAPVVGRVSMDLVTVDVSHLPDAAVTPGGLVELIGPNRPVDTVASEGGTIGYEILTS
LGARYHRVYRDPPPPEVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory