Comparing AZOBR_RS08390 AZOBR_RS08390 3-oxoacyl-ACP synthase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
57% identity, 99% coverage: 4:245/245 of query aligns to 3:244/244 of 6t77A
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
55% identity, 100% coverage: 1:245/245 of query aligns to 3:247/247 of 3op4A
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
56% identity, 99% coverage: 4:245/245 of query aligns to 2:243/243 of 7emgB
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
56% identity, 99% coverage: 4:245/245 of query aligns to 3:244/244 of P0A2C9
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
56% identity, 99% coverage: 3:245/245 of query aligns to 1:243/243 of 1q7bA
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
56% identity, 100% coverage: 2:245/245 of query aligns to 1:244/244 of P0AEK2
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
56% identity, 99% coverage: 3:245/245 of query aligns to 1:243/243 of 1q7cA
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
54% identity, 100% coverage: 1:245/245 of query aligns to 3:243/243 of 4i08A
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
50% identity, 97% coverage: 7:244/245 of query aligns to 5:246/246 of 3osuA
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
50% identity, 98% coverage: 4:244/245 of query aligns to 3:247/247 of 4jroC
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
49% identity, 97% coverage: 7:244/245 of query aligns to 2:239/239 of 3sj7A
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
52% identity, 99% coverage: 2:244/245 of query aligns to 8:253/254 of 4ag3A
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
50% identity, 100% coverage: 1:245/245 of query aligns to 1:247/247 of P73574
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
47% identity, 97% coverage: 7:244/245 of query aligns to 6:243/244 of 6wprA
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
47% identity, 97% coverage: 7:244/245 of query aligns to 6:243/244 of 6t62A
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
52% identity, 99% coverage: 2:244/245 of query aligns to 14:254/255 of 4bo4C
3tzcA Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(y155f) from vibrio cholerae (see paper)
49% identity, 99% coverage: 1:242/245 of query aligns to 3:223/224 of 3tzcA
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
51% identity, 99% coverage: 2:244/245 of query aligns to 3:240/241 of 4bnzA
4bnxA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 6-(4-(2-chloroanilino)- 1h-quinazolin-2-ylidene)cyclohexa-2, 4-dien-1-one at 2.3a resolution (see paper)
50% identity, 99% coverage: 2:244/245 of query aligns to 3:239/239 of 4bnxA
4bnyA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 4-(2-phenylthieno(3,2-d) pyrimidin-4-yl)morpholine at 1.8a resolution (see paper)
50% identity, 99% coverage: 2:244/245 of query aligns to 2:238/239 of 4bnyA
>AZOBR_RS08390 AZOBR_RS08390 3-oxoacyl-ACP synthase
MFDLTGKKALVTGASGGIGAQIARALHAQGATVALSGTRVAPLEALAAELGERALVVPGN
LADAAGTEQLAKDAEAALGQIDILVNNAGLTRDQLAMRMKDDDWQSVLDVNLTAAFRLSR
AVLRGMMKRRWGRIIGITSIVGVTGNPGQANYAASKAGMIGMSKSLAAEVASRGITVNCV
APGFITTAMTDALNSEQKDKLLTAIPSGRMGEPGEIAAGVVYLASDEAAYVTGQTLHING
GMAMI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory