Comparing AZOBR_RS08470 FitnessBrowser__azobra:AZOBR_RS08470 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
34% identity, 97% coverage: 6:248/251 of query aligns to 4:254/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
34% identity, 96% coverage: 6:247/251 of query aligns to 4:253/253 of 1g9xB
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
31% identity, 98% coverage: 1:247/251 of query aligns to 1:238/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 96% coverage: 6:247/251 of query aligns to 2:235/240 of 6mjpA
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
31% identity, 92% coverage: 20:250/251 of query aligns to 16:243/253 of 6z5uK
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
31% identity, 92% coverage: 20:250/251 of query aligns to 18:245/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
31% identity, 92% coverage: 20:250/251 of query aligns to 18:245/263 of 7d08B
Sites not aligning to the query:
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
33% identity, 94% coverage: 3:237/251 of query aligns to 2:225/285 of 4yerA
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
31% identity, 91% coverage: 12:239/251 of query aligns to 12:220/353 of 1vciA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 94% coverage: 6:240/251 of query aligns to 1:233/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 94% coverage: 6:240/251 of query aligns to 2:234/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 94% coverage: 6:240/251 of query aligns to 2:234/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 94% coverage: 6:240/251 of query aligns to 2:234/344 of 6cvlD
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
30% identity, 96% coverage: 7:247/251 of query aligns to 4:241/262 of 7chaI
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
27% identity, 94% coverage: 6:240/251 of query aligns to 2:228/241 of 4u00A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 94% coverage: 6:240/251 of query aligns to 17:240/378 of P69874
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 96% coverage: 7:247/251 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
30% identity, 96% coverage: 7:247/251 of query aligns to 3:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
30% identity, 96% coverage: 7:247/251 of query aligns to 3:235/235 of 6mhzA
P34358 ABC transporter ced-7; Cell death protein 7 from Caenorhabditis elegans (see 2 papers)
31% identity, 84% coverage: 21:230/251 of query aligns to 562:759/1704 of P34358
Sites not aligning to the query:
>AZOBR_RS08470 FitnessBrowser__azobra:AZOBR_RS08470
MASDVILETRGLTKEFRGFVAVRDVSLRVKRGSIHALIGPNGAGKTTVFNLLTKFLQPST
GNILFNGRDITAVKPADVARLGIIRSFQISAVFPHLSVLENVRVGLQRPLGNSFHFWTSE
SVLDRLNGRAMELLEDVGLAGYAHRPAAELPYGRKRALEIATTLALEPEMLLLDEPMAGM
GHEDIDRIAALIKRVSANRTILMVEHNLSVVSNLSDWITVLARGEVLAEGPYAEVSRHPK
VREAYMGSGHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory