Comparing AZOBR_RS08650 FitnessBrowser__azobra:AZOBR_RS08650 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
48% identity, 99% coverage: 1:388/392 of query aligns to 1:394/395 of P06721
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
48% identity, 98% coverage: 5:388/392 of query aligns to 2:391/392 of 1cl1B
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
48% identity, 98% coverage: 5:388/392 of query aligns to 1:390/391 of 2gqnA
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
48% identity, 98% coverage: 5:388/392 of query aligns to 1:390/391 of 2fq6A
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
48% identity, 98% coverage: 5:388/392 of query aligns to 1:390/391 of 1cl2A
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
48% identity, 98% coverage: 5:388/392 of query aligns to 1:390/391 of 4itxA
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
47% identity, 99% coverage: 1:388/392 of query aligns to 4:397/398 of 8sadA
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
47% identity, 97% coverage: 7:388/392 of query aligns to 3:390/391 of 8u99A
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
47% identity, 97% coverage: 7:388/392 of query aligns to 3:390/391 of 8u98A
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
47% identity, 97% coverage: 7:388/392 of query aligns to 3:390/391 of 8sa9A
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
47% identity, 97% coverage: 7:388/392 of query aligns to 4:391/392 of 8sabA
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
36% identity, 98% coverage: 5:388/392 of query aligns to 2:373/373 of 4l0oH
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
32% identity, 97% coverage: 7:387/392 of query aligns to 9:394/396 of 4omaA
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
32% identity, 97% coverage: 7:387/392 of query aligns to 9:394/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
32% identity, 97% coverage: 7:387/392 of query aligns to 9:394/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
32% identity, 97% coverage: 7:387/392 of query aligns to 9:394/396 of 3jw9A
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
32% identity, 97% coverage: 7:387/392 of query aligns to 9:394/396 of 4hf8A
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
32% identity, 97% coverage: 7:387/392 of query aligns to 8:393/395 of 5m3zA
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
34% identity, 97% coverage: 5:386/392 of query aligns to 2:377/377 of 7d7oB
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
33% identity, 97% coverage: 7:387/392 of query aligns to 9:394/396 of 6egrA
>AZOBR_RS08650 FitnessBrowser__azobra:AZOBR_RS08650
MKDARKDTVLGHAGRSPRENHGIVNPPVYHCSTVLFPTLEDLEAGDHAPFDRINYGRIGT
PTTLAFEQAITELEGAYRSVNTGSGLNAIATALFAFTKTGDHVLITDSAYGPTRRFANDT
LVPYGVEVEYFDPTIGAGITRLLKPNTSVVFLESPGSLTFEVQDVPAIAAAAKTVGATVM
IDNTWATPLFFQPLRHGVDVSIHSATKYIVGHADAMLGVISCANEAQWLAVKKAATRTGT
CAGPDDIYLGLRGLRTLSVRLKQHEASALALAEWLSKQPEVTRILHPAFPDCPGHELWKR
DIGRSSGLFSIVMNTVPKPALSAMLNSLELFGLGYSWGGFESLILPARPAAIRTATRWTD
PGTMLRLHAGLEDVDDLIRDLDGAFARLRAAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory