Comparing AZOBR_RS08660 AZOBR_RS08660 ABC transporter permease to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
33% identity, 32% coverage: 266:394/399 of query aligns to 86:214/215 of 4ymtC
Sites not aligning to the query:
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
33% identity, 32% coverage: 266:394/399 of query aligns to 86:214/214 of 4ymwC
Sites not aligning to the query:
>AZOBR_RS08660 AZOBR_RS08660 ABC transporter permease
VASETRDTARPSAPGGVSFSLSDPTVRAVFYQVLVVGIVIAVGWFLIHNTLDNLSKRSIA
TGFGFLDREASFGIGESLIDYHPRDSYGRAFLVGVLNTLKVSIIGVVLATVLGTLIGVAR
LSSNWLIAKLASTYVEIVRNIPPLLQLFFWYALVSESMPPVRQALNPIPGVFLSQRGLFV
PVPSADPVWGTMGFALAIAVIGVIFLRRWAKARQERTGQPFPIGTASLSLLIGLPLIAYI
AGGAPTALDVPKLQGFNFVGGVVLTPEFFAILVGLVVYTAAFIAEVVRSGILAVNWGQTE
AARALGIDSGKTLRLVVLPQALRVIVPPLTSQYLNLTKNSSLALAIGYPDLVSIANTTLN
QTGQAIEGVAMIMGTYLVISLGISIFMNWYNKRIALVER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory