SitesBLAST
Comparing AZOBR_RS09095 FitnessBrowser__azobra:AZOBR_RS09095 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
29% identity, 80% coverage: 2:254/317 of query aligns to 2:264/307 of 6wjaA
- active site: A118 (≠ S115), A119 (≠ V116), A120 (≠ K117), F143 (≠ Y140), K147 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (vs. gap), D32 (vs. gap), S34 (≠ A29), T35 (≠ V30), G36 (≠ V31), A55 (≠ I50), L74 (= L69), A75 (= A70), A76 (= A71), S93 (≠ V90), F143 (≠ Y140), K147 (= K144), F170 (≠ P167), F171 (≠ P168), I173 (≠ V170)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V75), A120 (≠ K117), N172 (≠ L169), G186 (= G174), V187 (= V175), F191 (= F179), T202 (≠ P193), F204 (vs. gap), R211 (= R201), L247 (≠ T237)
Sites not aligning to the query:
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
29% identity, 80% coverage: 2:254/317 of query aligns to 3:265/308 of 6wj9B
- active site: A119 (≠ S115), A120 (≠ V116), A121 (≠ K117), F144 (≠ Y140), K148 (= K144)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (≠ V12), D32 (vs. gap), D33 (vs. gap), S35 (≠ A29), T36 (≠ V30), G37 (≠ V31), D55 (= D49), A56 (≠ I50), L75 (= L69), A76 (= A70), A77 (= A71), S94 (≠ V90), A117 (≠ L113), A119 (≠ S115), F144 (≠ Y140), K148 (= K144), F171 (≠ P167), F172 (≠ P168), I174 (≠ V170)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V75), N173 (≠ L169), G187 (= G174), V188 (= V175), F192 (= F179), T203 (≠ P193), L204 (= L194), F205 (vs. gap), R212 (= R201), L248 (≠ T237)
Sites not aligning to the query:
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
30% identity, 99% coverage: 1:313/317 of query aligns to 1:309/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (vs. gap), N32 (vs. gap), T35 (≠ V30), G36 (≠ V31), D56 (= D49), I57 (= I50), L77 (= L69), A78 (= A70), A79 (= A71), I81 (≠ V73), T119 (≠ L113), Y146 (= Y140), K150 (= K144), P173 (= P167), N175 (≠ L169), V176 (= V170)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ V73), R84 (≠ M76), S121 (= S115), G123 (≠ K117), S124 (≠ A118), Y146 (= Y140), A174 (≠ P168), N175 (≠ L169), G188 (= G177), V189 (≠ N178), F193 (≠ L182), R204 (≠ P193), V205 (≠ L194), F206 (≠ G195), N211 (≠ R200), R213 (≠ S202), D248 (≠ T237), R271 (≠ S260)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
30% identity, 99% coverage: 1:313/317 of query aligns to 1:309/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ V73), R84 (≠ M76), S121 (= S115), G123 (≠ K117), Y146 (= Y140), A174 (≠ P168), N175 (≠ L169), A187 (≠ G176), G188 (= G177), V189 (≠ N178), F193 (≠ L182), R204 (≠ P193), F206 (≠ G195), N211 (≠ R200), R213 (≠ S202), D248 (≠ T237), R271 (≠ S260)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (vs. gap), N32 (vs. gap), A34 (= A29), T35 (≠ V30), G36 (≠ V31), D56 (= D49), I57 (= I50), L77 (= L69), A78 (= A70), A79 (= A71), I81 (≠ V73), T119 (≠ L113), Y146 (= Y140), K150 (= K144), P173 (= P167), A174 (≠ P168), V176 (= V170)
- binding uridine-5'-diphosphate-glucose: I81 (≠ V73), R84 (≠ M76), S121 (= S115), G123 (≠ K117), Y146 (= Y140), A174 (≠ P168), N175 (≠ L169), A187 (≠ G176), G188 (= G177), V189 (≠ N178), F193 (≠ L182), R204 (≠ P193), F206 (≠ G195), N211 (≠ R200), R213 (≠ S202), D248 (≠ T237), R271 (≠ S260)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
30% identity, 99% coverage: 1:313/317 of query aligns to 1:309/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (vs. gap), N32 (vs. gap), T35 (≠ V30), G36 (≠ V31), D56 (= D49), I57 (= I50), L77 (= L69), A78 (= A70), A79 (= A71), I81 (≠ V73), V96 (= V90), T119 (≠ L113), Y146 (= Y140), K150 (= K144), P173 (= P167), A174 (≠ P168), N175 (≠ L169), V176 (= V170)
- binding uridine-5'-diphosphate-glucose: I81 (≠ V73), R84 (≠ M76), S121 (= S115), G123 (≠ K117), Y146 (= Y140), A174 (≠ P168), N175 (≠ L169), A187 (≠ G176), G188 (= G177), V189 (≠ N178), F193 (≠ L182), R204 (≠ P193), V205 (≠ L194), F206 (≠ G195), R213 (≠ S202), D248 (≠ T237), R271 (≠ S260)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
26% identity, 100% coverage: 1:317/317 of query aligns to 1:316/322 of 1r6dA
- active site: T127 (≠ S115), N128 (≠ V116), Q129 (≠ K117), Y151 (= Y140), K155 (= K144)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ V73), H88 (= H74), T127 (≠ S115), N128 (≠ V116), Q129 (≠ K117), Y151 (= Y140), N180 (≠ L169), K190 (≠ R188), L191 (≠ G189), P206 (≠ I204), Y208 (≠ V206), R215 (≠ I213), N250 (≠ T237), R274 (= R271), H277 (≠ M274), Y281 (≠ V278)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (≠ V12), D37 (= D43), S38 (≠ T44), L39 (≠ V45), T40 (= T46), A42 (vs. gap), G43 (vs. gap), D63 (= D49), I64 (= I50), F83 (≠ L69), A84 (= A70), A85 (= A71), S87 (≠ V73), T102 (≠ V90), V125 (≠ L113), S126 (= S114), Y151 (= Y140), K155 (= K144), N181 (≠ V170)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
26% identity, 100% coverage: 1:317/317 of query aligns to 1:316/322 of 1r66A
- active site: T127 (≠ S115), D128 (≠ V116), E129 (≠ K117), Y151 (= Y140), K155 (= K144)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (≠ V12), D37 (= D43), S38 (≠ T44), L39 (≠ V45), T40 (= T46), G43 (vs. gap), D63 (= D49), I64 (= I50), F83 (≠ L69), A84 (= A70), A85 (= A71), S87 (≠ V73), T102 (≠ V90), V125 (≠ L113), S126 (= S114), Y151 (= Y140), K155 (= K144), N181 (≠ V170)
- binding thymidine-5'-diphosphate: H88 (= H74), E129 (≠ K117), N180 (≠ L169), K190 (≠ R188), L191 (≠ G189), P206 (≠ I204), Y208 (≠ V206), R215 (≠ I213), N250 (≠ T237), R274 (= R271), H277 (≠ M274)
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
31% identity, 81% coverage: 3:258/317 of query aligns to 3:282/328 of 4id9B
- active site: S107 (= S115), Y133 (= Y140), K137 (= K144)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), R11 (≠ F11), V12 (= V12), D31 (≠ V31), L32 (≠ R32), S45 (≠ D49), L46 (≠ I50), L65 (= L69), A67 (= A71), V82 (= V90), Y133 (= Y140), K137 (= K144), F160 (vs. gap), S161 (vs. gap), H162 (vs. gap), T163 (vs. gap)
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
31% identity, 81% coverage: 3:258/317 of query aligns to 2:281/321 of 4id9A
- active site: S106 (= S115), Y132 (= Y140), K136 (= K144)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), R10 (≠ F11), V11 (= V12), D30 (≠ V31), L31 (≠ R32), R32 (= R33), S44 (≠ D49), L45 (≠ I50), L64 (= L69), A66 (= A71), V81 (= V90), S106 (= S115), Y132 (= Y140), K136 (= K144), F159 (vs. gap), H161 (vs. gap), T162 (vs. gap)
Sites not aligning to the query:
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
25% identity, 99% coverage: 1:313/317 of query aligns to 1:305/309 of 4zrnA
- active site: T117 (≠ S115), G119 (≠ K117), A120 (= A118), Y143 (= Y140), K147 (= K144), Y181 (vs. gap), G185 (= G177)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (= D43), N32 (≠ T44), S34 (≠ T46), S35 (≠ I47), G36 (= G48), S51 (≠ A59), I52 (≠ L60), L73 (= L69), A74 (= A70), A75 (= A71), T92 (≠ V90), S115 (≠ L113), S116 (= S114), Y143 (= Y140), K147 (= K144), Y170 (≠ P167), V173 (= V170)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S115), G119 (≠ K117), A120 (= A118), Y143 (= Y140), N172 (≠ L169), G185 (= G177), V186 (≠ N178), H201 (≠ P193), F203 (vs. gap), Y208 (≠ N199), R210 (= R201), V244 (≠ T237), R267 (≠ S260), D270 (≠ A269)
2p5uA Crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with NAD
30% identity, 99% coverage: 1:314/317 of query aligns to 1:309/311 of 2p5uA
- active site: T117 (≠ S115), G119 (≠ K117), A120 (= A118), Y143 (= Y140), K147 (= K144), H181 (vs. gap), G185 (= G177)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (vs. gap), N32 (vs. gap), L33 (vs. gap), A34 (= A29), T35 (≠ V30), G36 (≠ V31), D51 (≠ T46), L52 (≠ I47), Q73 (≠ L69), A74 (= A70), A75 (= A71), A77 (≠ V73), S116 (= S114), Y143 (= Y140), K147 (= K144), V173 (= V170)
4r1sA Crystal structure of petunia hydrida cinnamoyl-coa reductase (see paper)
33% identity, 54% coverage: 3:173/317 of query aligns to 6:187/319 of 4r1sA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), F14 (= F11), I15 (≠ V12), R35 (= R32), K41 (vs. gap), D61 (= D49), L62 (≠ I50), T81 (≠ L69), S83 (≠ A71), T118 (≠ L113), Y154 (= Y140), K158 (= K144), P181 (= P167), L183 (= L169), V184 (= V170)
Sites not aligning to the query:
A0A059TC02 Cinnamoyl-CoA reductase 1; Ph-CCR1; Coniferylaldehyde synthase; Coumaroyl-CoA reductase; Feruloyl-CoA reductase; Sinapoyl-CoA reductase; EC 1.2.1.44 from Petunia hybrida (Petunia) (see paper)
33% identity, 54% coverage: 3:173/317 of query aligns to 9:190/333 of A0A059TC02
- 13:19 (vs. 7:13, 71% identical) binding
- R38 (= R32) binding
- K44 (vs. gap) binding
- DL 64:65 (≠ DI 49:50) binding
- TAS 84:86 (≠ LAA 69:71) binding
- C150 (vs. gap) modified: Disulfide link with 158; mutation C->A,S: Increased activity.
- Y157 (= Y140) binding
- C158 (≠ G141) modified: Disulfide link with 150; mutation to A: Increased activity.; mutation to S: Reduced activity.
- K161 (= K144) binding
- PVLV 184:187 (≠ PPLV 167:170) binding
Sites not aligning to the query:
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
25% identity, 100% coverage: 1:316/317 of query aligns to 1:313/313 of 6bwlA
- active site: T122 (≠ S115), C123 (≠ V116), M124 (≠ K117), Y147 (= Y140), K151 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (≠ V31), N32 (≠ R32), L33 (≠ R33), N35 (≠ D35), S36 (≠ I36), D57 (= D49), I58 (= I50), L79 (= L69), A80 (= A70), A81 (= A71), I83 (≠ V73), M120 (≠ L113), K151 (= K144), N176 (≠ L169), T177 (≠ V170)
- binding uridine-5'-diphosphate: N176 (≠ L169), G189 (= G177), V190 (≠ N178), N205 (≠ P193), I206 (≠ L194), Y207 (vs. gap), Q212 (≠ N199), R214 (= R201), I250 (≠ T237), E275 (≠ R267)
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
25% identity, 99% coverage: 1:314/317 of query aligns to 1:336/361 of 1kewA
- active site: T133 (≠ S115), D134 (≠ V116), E135 (≠ K117), L152 (vs. gap), L154 (vs. gap), F155 (≠ L128), T158 (≠ E131), Y167 (= Y140), K171 (= K144)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (≠ V12), D32 (≠ R32), K33 (≠ R33), L34 (≠ V38), T35 (≠ P39), A37 (= A41), G38 (≠ A42), D58 (≠ G62), I59 (≠ M63), L80 (= L69), A81 (= A70), A82 (= A71), S84 (≠ V73), T99 (≠ V90), I131 (≠ L113), S132 (= S114), T133 (≠ S115), Y167 (= Y140), K171 (= K144), C194 (≠ P167), N196 (≠ L169), N197 (≠ V170)
- binding thymidine-5'-diphosphate: E135 (≠ K117), N196 (≠ L169), K206 (vs. gap), L207 (vs. gap), P222 (= P193), Y224 (vs. gap), R231 (= R201), N266 (≠ T237), R297 (= R271), H300 (≠ M274)
Sites not aligning to the query:
1keuA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with dtdp-d-glucose bound (see paper)
25% identity, 99% coverage: 1:314/317 of query aligns to 1:336/361 of 1keuA
- active site: T133 (≠ S115), D134 (≠ V116), E135 (≠ K117), L152 (vs. gap), L154 (vs. gap), F155 (≠ L128), T158 (≠ E131), Y167 (= Y140), K171 (= K144)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S84 (≠ V73), T133 (≠ S115), D134 (≠ V116), E135 (≠ K117), Y167 (= Y140), N196 (≠ L169), K206 (vs. gap), L207 (vs. gap), P222 (= P193), Y224 (vs. gap), R231 (= R201), N266 (≠ T237), R297 (= R271), H300 (≠ M274)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (≠ V12), D32 (≠ R32), K33 (≠ R33), L34 (≠ V38), T35 (≠ P39), G38 (≠ A42), D58 (≠ G62), L80 (= L69), A81 (= A70), A82 (= A71), S84 (≠ V73), T99 (≠ V90), S132 (= S114), T133 (≠ S115), Y167 (= Y140), K171 (= K144), C194 (≠ P167), N196 (≠ L169), N197 (≠ V170)
Sites not aligning to the query:
P26391 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
25% identity, 99% coverage: 1:314/317 of query aligns to 1:336/361 of P26391
Sites not aligning to the query:
H1ZZB0 Aurachin B dehydrogenase; EC 1.1.1.394 from Stigmatella aurantiaca (see paper)
28% identity, 81% coverage: 1:258/317 of query aligns to 1:255/334 of H1ZZB0
- S111 (= S114) mutation to A: Does not produce aurachin B.
- Y139 (= Y140) mutation to F: Does not produce aurachin B.
6x3bB Structure of rmd from pseudomonas aeruginosa complexed with NADPH
29% identity, 78% coverage: 1:246/317 of query aligns to 2:243/297 of 6x3bB
- active site: S104 (= S115), G105 (vs. gap), D106 (vs. gap), Y130 (= Y140), K134 (= K144)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), S10 (≠ T9), G11 (= G10), F12 (= F11), V13 (= V12), D38 (= D43), L39 (≠ T44), L59 (= L69), A60 (= A70), G61 (≠ A71), T63 (≠ V73), I102 (≠ L113), Y130 (= Y140), K134 (= K144), H160 (≠ V170), Q165 (≠ V175)
- binding pyrophosphate 2-: D106 (vs. gap), R199 (= R201)
6x3bA Structure of rmd from pseudomonas aeruginosa complexed with NADPH
29% identity, 78% coverage: 1:246/317 of query aligns to 6:247/300 of 6x3bA
- active site: S108 (= S115), G109 (vs. gap), D110 (vs. gap), Y134 (= Y140), K138 (= K144)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G7), S14 (≠ T9), G15 (= G10), F16 (= F11), V17 (= V12), D42 (= D43), L43 (≠ T44), L63 (= L69), A64 (= A70), G65 (≠ A71), T67 (≠ V73), Y134 (= Y140), K138 (= K144), H164 (≠ V170), Q169 (≠ V175)
Query Sequence
>AZOBR_RS09095 FitnessBrowser__azobra:AZOBR_RS09095
MRVLVTGATGFVARTVIPLLVERGHSVRAVVRRPDIPVPHAADTVTIGDIGPATAWGNAL
QGMDAVVHLAARVHVMRDRESDPLAAFRRVNTAGTRVLAEAAAAAGVKRMVYLSSVKALA
DESRPDELSEETEPDPHSPYGISKLEAERALAEISARTGLEAVVIRPPLVYGPGVGGNFL
RLMQAVDRGIPLPLGALENRRSLIFVGNLADAIQECLTHPQAAGGRFLVHDGRPMSTAEL
VRAIAEALGKPARLLPVPPSLLALAARLARREAMLDRVAGSLVIDDGAIRRALNWRPPCY
PAYGLRLTAEWFKAVRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory