SitesBLAST
Comparing AZOBR_RS09410 AZOBR_RS09410 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
43% identity, 98% coverage: 3:249/253 of query aligns to 4:244/246 of 4hp8B
- active site: G19 (= G18), S138 (= S144), V148 (= V154), Y151 (= Y157), K155 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), N17 (≠ S16), T18 (≠ A17), G19 (= G18), L20 (= L19), R40 (= R39), R41 (= R40), D63 (= D64), F64 (≠ V65), N85 (= N91), G87 (= G93), I88 (≠ A94), I136 (= I142), Y151 (= Y157), K155 (= K161), P181 (= P187), G182 (= G188), I184 (≠ M190), T186 (= T192), N188 (= N195), T189 (≠ R196)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
42% identity, 98% coverage: 5:251/253 of query aligns to 3:254/256 of 7do7A
- active site: G16 (= G18), S146 (= S144), Y159 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), R15 (≠ A17), G16 (= G18), I17 (≠ L19), S37 (vs. gap), D66 (= D64), A67 (≠ V65), N93 (= N91), A94 (= A92), G95 (= G93), I96 (≠ A94), V144 (≠ I142), S145 (≠ A143), S146 (= S144), Y159 (= Y157), K163 (= K161), P189 (= P187), G190 (= G188), I192 (≠ M190), T194 (= T192), I196 (≠ L194)
- binding beta-L-rhamnopyranose: F99 (≠ A97), S146 (= S144), S148 (≠ L146), Q156 (≠ V154), Y159 (= Y157), N197 (= N195), D235 (= D232), M236 (≠ A233), R238 (≠ A235)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
42% identity, 98% coverage: 5:251/253 of query aligns to 3:254/256 of 7b81A
- active site: G16 (= G18), S146 (= S144), Y159 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S14 (= S16), R15 (≠ A17), I17 (≠ L19), D66 (= D64), A67 (≠ V65), N93 (= N91), A94 (= A92), G95 (= G93), I96 (≠ A94), T116 (= T114), V144 (≠ I142), S146 (= S144), Y159 (= Y157), K163 (= K161), P189 (= P187), G190 (= G188), I192 (≠ M190), T194 (= T192), I196 (≠ L194)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
37% identity, 98% coverage: 2:249/253 of query aligns to 5:245/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G14), D19 (≠ S16), L22 (= L19), I42 (≠ R40), D65 (= D64), M66 (≠ V65), N92 (= N91), A93 (= A92), G94 (= G93), L115 (≠ T114), I143 (= I142), S145 (= S144), Y158 (= Y157), K162 (= K161), G189 (= G188), M191 (= M190), T193 (= T192), N195 (≠ L194)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
39% identity, 95% coverage: 8:247/253 of query aligns to 5:243/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
38% identity, 95% coverage: 8:247/253 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G18), S138 (= S144), Q148 (≠ V154), Y151 (= Y157), K155 (= K161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (= S16), R11 (≠ A17), I13 (≠ L19), N31 (≠ A37), Y32 (vs. gap), A33 (= A38), G34 (≠ R39), S35 (≠ R40), A58 (≠ L63), N59 (≠ D64), V60 (= V65), N86 (= N91), A87 (= A92), T109 (= T114), S138 (= S144), Y151 (= Y157), K155 (= K161), P181 (= P187), G182 (= G188)
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
41% identity, 98% coverage: 5:251/253 of query aligns to 3:245/247 of 7do6A
- active site: G16 (= G18), S146 (= S144), Y159 (= Y157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (≠ A17), G16 (= G18), I17 (≠ L19), H36 (vs. gap), S37 (vs. gap), G42 (≠ R40), D66 (= D64), A67 (≠ V65), N93 (= N91), A94 (= A92), G95 (= G93), I96 (≠ A94), T116 (= T114), S146 (= S144), Y159 (= Y157), K163 (= K161), I192 (≠ M190)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 98% coverage: 1:248/253 of query aligns to 1:252/255 of 5itvA
- active site: G18 (= G18), S141 (= S144), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ A17), G18 (= G18), I19 (≠ L19), D38 (≠ E50), I39 (= I51), T61 (≠ L63), I63 (≠ V65), N89 (= N91), G91 (= G93), T139 (≠ I142), S141 (= S144), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (= G188), I186 (≠ Y189), I187 (≠ M190)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
39% identity, 98% coverage: 3:250/253 of query aligns to 4:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G14), R18 (≠ A17), G19 (= G18), I20 (≠ L19), D39 (≠ A38), R40 (= R39), C63 (≠ L63), I65 (≠ V65), N91 (= N91), G93 (= G93), I94 (≠ A94), V114 (≠ T114), Y155 (= Y157), K159 (= K161), I188 (≠ M190), T190 (= T192), T193 (≠ N195)
8jfgA Crystal structure of 3-oxoacyl-acp reductase fabg in complex with NADP+ and 3-keto-octanoyl-acp from helicobacter pylori (see paper)
36% identity, 97% coverage: 2:247/253 of query aligns to 1:245/248 of 8jfgA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), K16 (≠ A17), I18 (≠ L19), R38 (= R39), A65 (≠ V65), N91 (= N91), A92 (= A92), G93 (= G93), A142 (= A143), S143 (= S144), Y156 (= Y157), K160 (= K161), P186 (= P187), I189 (≠ M190), T191 (= T192), M193 (≠ L194), N194 (= N195)
- binding ~{S}-[2-[3-[[(2~{S})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] 3-oxidanylideneoctanethioate: D97 (≠ A97), S143 (= S144), I145 (≠ L146), M151 (≠ G152), G152 (≠ H153), Q153 (≠ V154), Y156 (= Y157), G187 (= G188), F188 (≠ Y189), Y205 (≠ L207)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
36% identity, 96% coverage: 5:247/253 of query aligns to 11:255/267 of 3ay6B
- active site: G24 (= G18), S151 (= S144), Y164 (= Y157), K168 (= K161)
- binding beta-D-glucopyranose: E102 (≠ T95), S151 (= S144), H153 (≠ L146), W158 (≠ A151), Y164 (= Y157), N202 (= N195), K205 (≠ F198)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G14), T23 (≠ A17), G24 (= G18), L25 (= L19), Y45 (vs. gap), D71 (= D64), V72 (= V65), N98 (= N91), A99 (= A92), G100 (= G93), V101 (≠ A94), M149 (≠ I142), S151 (= S144), Y164 (= Y157), K168 (= K161), P194 (= P187), G195 (= G188), M197 (= M190), T199 (= T192), P200 (≠ D193), I201 (≠ L194), N202 (= N195)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 97% coverage: 5:250/253 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G18), S142 (= S144), Q152 (≠ V154), Y155 (= Y157), K159 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (≠ A17), G16 (= G18), I17 (≠ L19), N35 (≠ A37), Y36 (≠ A38), N37 (≠ R39), G38 (≠ R40), S39 (≠ R41), N63 (≠ D64), V64 (= V65), N90 (= N91), A91 (= A92), I93 (≠ A94), I113 (≠ T114), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (≠ M190), T190 (= T192)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
39% identity, 97% coverage: 5:250/253 of query aligns to 4:246/247 of P73574
- A14 (= A15) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ G152) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K161) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ Y189) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ L199) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
37% identity, 97% coverage: 3:247/253 of query aligns to 2:248/252 of 1vl8B
- active site: G17 (= G18), S143 (= S144), I154 (≠ V154), Y157 (= Y157), K161 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), R16 (≠ A17), G17 (= G18), L18 (= L19), S37 (≠ A38), R38 (= R39), C63 (≠ L63), D64 (= D64), V65 (= V65), A91 (≠ N91), A92 (= A92), G93 (= G93), I94 (≠ A94), V114 (≠ T114), I141 (= I142), S143 (= S144), Y157 (= Y157), K161 (= K161), P187 (= P187), G188 (= G188), Y190 (≠ M190), T192 (= T192), M194 (≠ L194), T195 (≠ N195)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
35% identity, 96% coverage: 5:248/253 of query aligns to 11:263/267 of Q9LBG2
- 17:42 (vs. 11:36, 54% identical) binding
- E103 (≠ T95) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
35% identity, 96% coverage: 5:248/253 of query aligns to 2:254/258 of 1iy8A
- active site: G15 (= G18), S143 (= S144), Q153 (≠ V154), Y156 (= Y157), K160 (= K161)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), S14 (≠ A17), G15 (= G18), L16 (= L19), D35 (≠ A38), V36 (≠ R39), A62 (≠ L63), D63 (= D64), V64 (= V65), N90 (= N91), G92 (= G93), I93 (≠ A94), T141 (≠ I142), S143 (= S144), Y156 (= Y157), K160 (= K161), P186 (= P187), G187 (= G188), T191 (= T192), P192 (≠ D193), M193 (≠ L194)
2ekpA Structure of tt0495 protein from thermus thermophilus (see paper)
39% identity, 96% coverage: 7:249/253 of query aligns to 1:236/238 of 2ekpA
- active site: G12 (= G18), S128 (= S144), Y143 (= Y157), K147 (= K161)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), S10 (= S16), G12 (= G18), I13 (≠ L19), S32 (≠ A38), T49 (≠ L63), D50 (= D64), L51 (≠ V65), A76 (≠ N91), A78 (≠ G93), I126 (= I142), G127 (≠ A143), Y143 (= Y157), K147 (= K161), P173 (= P187), G174 (= G188), V176 (≠ M190), T178 (= T192), F180 (≠ L194), T181 (≠ N195)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 95% coverage: 8:247/253 of query aligns to 6:240/244 of P0AEK2
- GASR 12:15 (≠ GASA 14:17) binding
- T37 (≠ R40) binding
- NV 59:60 (≠ DV 64:65) binding
- N86 (= N91) binding
- Y151 (= Y157) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YTASK 157:161) binding
- A154 (≠ S160) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K161) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ M190) binding
- E233 (≠ A240) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
38% identity, 95% coverage: 8:247/253 of query aligns to 5:239/243 of 1q7bA
- active site: G15 (= G18), E101 (= E107), S137 (= S144), Q147 (≠ V154), Y150 (= Y157), K154 (= K161)
- binding calcium ion: E232 (≠ A240), T233 (≠ V241)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (= S16), R14 (≠ A17), T36 (≠ R40), N58 (≠ D64), V59 (= V65), N85 (= N91), A86 (= A92), G87 (= G93), I88 (≠ A94), S137 (= S144), Y150 (= Y157), K154 (= K161), P180 (= P187), G181 (= G188), I183 (≠ M190)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
40% identity, 96% coverage: 5:247/253 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ A17) binding
- D36 (≠ A38) binding
- D62 (= D64) binding
- I63 (≠ V65) binding
- N89 (= N91) binding
- Y153 (= Y157) binding
- K157 (= K161) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>AZOBR_RS09410 AZOBR_RS09410 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase
MTFPLTNRTALVTGASAGLGRHFAGVLAAAGARVALAARRRESLDAAVAEIEAAGGQAIA
VPLDVTDAASVRNGVREAAGALGGLDILVNNAGATVAKPALDYAEEEWDRVIDTNLKGAF
LTAQETARVMREQGRGGSIVNIASILGLRVAGHVVAYTASKAGLVQMTQAVALEWARYGI
RVNALAPGYMETDLNRDFLATDAGQALIRRVPQRRLGRLADLDGPLLLLCSDASAYMTGA
VVPVDGGHLVSTL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory