Comparing AZOBR_RS09435 FitnessBrowser__azobra:AZOBR_RS09435 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 85% coverage: 21:238/257 of query aligns to 22:242/271 of Q9M8S8
Q19420 Inositol monophosphatase ttx-7; IMP; IMPase; Abnormal thermotaxis protein 7; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase; EC 3.1.3.25; EC 3.1.3.94 from Caenorhabditis elegans (see paper)
29% identity, 77% coverage: 43:240/257 of query aligns to 49:253/285 of Q19420
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
29% identity, 92% coverage: 17:253/257 of query aligns to 12:250/262 of 2qflA
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 92% coverage: 17:253/257 of query aligns to 12:250/267 of P0ADG4
Sites not aligning to the query:
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
29% identity, 92% coverage: 17:253/257 of query aligns to 16:254/270 of 6ib8B
Q9K4B1 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
32% identity, 83% coverage: 26:239/257 of query aligns to 25:240/266 of Q9K4B1
6giuA Human impase with l-690330 (see paper)
26% identity, 88% coverage: 15:240/257 of query aligns to 12:241/275 of 6giuA
6zk0AAA human impase with ebselen (see paper)
26% identity, 88% coverage: 15:240/257 of query aligns to 11:240/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
26% identity, 88% coverage: 15:240/257 of query aligns to 12:241/274 of 4as4A
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
26% identity, 88% coverage: 15:240/257 of query aligns to 10:239/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
26% identity, 88% coverage: 15:240/257 of query aligns to 10:239/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
26% identity, 88% coverage: 15:240/257 of query aligns to 10:239/272 of 1awbA
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
26% identity, 88% coverage: 15:240/257 of query aligns to 10:239/266 of 1imdA
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
26% identity, 88% coverage: 15:240/257 of query aligns to 14:243/277 of P29218
2p3nA Thermotoga maritima impase tm1415 (see paper)
29% identity, 77% coverage: 43:239/257 of query aligns to 38:223/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
29% identity, 77% coverage: 43:239/257 of query aligns to 38:223/256 of O33832
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 83% coverage: 25:237/257 of query aligns to 22:233/260 of P95189
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
32% identity, 83% coverage: 25:237/257 of query aligns to 20:231/256 of 5zonA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
33% identity, 83% coverage: 25:237/257 of query aligns to 19:230/255 of 5yhtA
C4M633 Inositol polyphosphate 1-phosphatase; EhIPPase; 3'(2'),5'-bisphosphate nucleotidase; EC 3.1.3.57; EC 3.1.3.7 from Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) (see paper)
26% identity, 89% coverage: 15:242/257 of query aligns to 14:248/285 of C4M633
>AZOBR_RS09435 FitnessBrowser__azobra:AZOBR_RS09435
MTDTAAASLLPKVRTIAHEAGQVILRFYNDGIDAATKVDGSPVTQADLAAEHVITPALHH
IAPGIPVVAEEAVAAGHRPDISGGRFWLVDPLDGTKEFISRNGEFTVNIALIDGGRPVLG
VVYAPATGDLYAACGAGTAVHWVEGRHDYPIQVRKPPPDGLTVVASRSHGSGSELDGFLA
GYTVKNRVTCGSSLKFCTVASGKADLYPRFGPTSEWDTAAGHAILAAAGGRVEQPDGSPF
LYGKADIVNPHFVAYGW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory