SitesBLAST
Comparing AZOBR_RS09450 FitnessBrowser__azobra:AZOBR_RS09450 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5x7uA Trehalose synthase from thermobaculum terrenum (see paper)
65% identity, 50% coverage: 13:566/1107 of query aligns to 1:545/546 of 5x7uA
- active site: E97 (= E109), R197 (= R210), D199 (= D212), E241 (= E254), H306 (= H323), D307 (= D324)
- binding magnesium ion: D20 (= D32), N22 (≠ D34), D24 (= D36), S26 (≠ I38), D28 (= D40), N101 (= N113), D169 (= D182), Y203 (= Y216), L204 (= L217), E206 (= E219), R352 (≠ K369), H531 (≠ Y552)
A0R6E0 Trehalose synthase/amylase TreS; Maltose alpha-D-glucosyltransferase; MTase; EC 3.2.1.1; EC 5.4.99.16 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
62% identity, 50% coverage: 12:559/1107 of query aligns to 31:582/593 of A0R6E0
- N132 (= N113) binding
- D200 (= D182) binding
- D230 (= D212) active site, Nucleophile
- Y234 (= Y216) binding
- L235 (= L217) binding
- E237 (= E219) binding
5jy7B Complex of mycobacterium smegmatis trehalose synthase with maltokinase (see paper)
62% identity, 50% coverage: 12:559/1107 of query aligns to 15:566/571 of 5jy7B
3zoaB The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
62% identity, 50% coverage: 12:559/1107 of query aligns to 15:566/571 of 3zoaB
- active site: D112 (≠ E109), R212 (= R210), D214 (= D212), E256 (= E254), H325 (= H323), D326 (= D324)
- binding calcium ion: N116 (= N113), D184 (= D182), Y218 (= Y216), L219 (= L217), E221 (= E219)
- binding alpha-D-glucopyranose: R518 (= R511), F519 (≠ S512)
- binding magnesium ion: D35 (= D32), N37 (≠ D34), D39 (= D36), I41 (= I38), D43 (= D40)
3zo9A The structure of trehalose synthase (tres) of mycobacterium smegmatis (see paper)
63% identity, 50% coverage: 12:559/1107 of query aligns to 3:545/549 of 3zo9A
- active site: D100 (≠ E109), R200 (= R210), D202 (= D212), E244 (= E254), H313 (= H323), D314 (= D324)
- binding calcium ion: N104 (= N113), D172 (= D182), Y206 (= Y216), L207 (= L217), E209 (= E219)
- binding magnesium ion: D23 (= D32), N25 (≠ D34), D27 (= D36), I29 (= I38), D31 (= D40)
3zoaA The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
63% identity, 50% coverage: 12:559/1107 of query aligns to 2:544/548 of 3zoaA
- active site: D99 (≠ E109), R199 (= R210), D201 (= D212), E243 (= E254), H312 (= H323), D313 (= D324)
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: W447 (= W458), M451 (≠ L462), E515 (= E530), M516 (= M531), T517 (≠ L532), F539 (= F554), Y540 (= Y555), W541 (= W556)
- binding calcium ion: N103 (= N113), D171 (= D182), Y205 (= Y216), L206 (= L217), E208 (= E219)
- binding magnesium ion: D22 (= D32), N24 (≠ D34), D26 (= D36), I28 (= I38), D30 (= D40)
8uzhB Sumo fused trehalose synthase (tres) of mycobacterium tuberculosis (see paper)
61% identity, 50% coverage: 13:561/1107 of query aligns to 80:626/626 of 8uzhB
8uqvA Trehalose synthase (tres) of mycobacterium tuberculosis in complex with 6-treaz compound (see paper)
60% identity, 50% coverage: 13:561/1107 of query aligns to 1:547/547 of 8uqvA
- binding calcium ion: W160 (= W173), D169 (= D182), Y203 (= Y216), L204 (= L217), E206 (= E219)
- binding alpha-D-glucopyranose: D59 (= D71), Y62 (= Y74), D311 (= D324), R390 (= R403)
- binding 6-azido-6-deoxy-alpha-D-glucopyranose: E241 (= E254), N243 (= N256), E312 (= E325), T314 (= T327)
4lxfB Crystal structure of m. Tuberculosis tres (see paper)
57% identity, 50% coverage: 13:561/1107 of query aligns to 29:546/546 of 4lxfB
5gtwA The n253r mutant structures of trehalose synthase from deinococcus radiodurans display two different active-site conformations
55% identity, 49% coverage: 16:561/1107 of query aligns to 3:548/548 of 5gtwA
- active site: D96 (≠ E109), R202 (= R210), D204 (= D212), E246 (= E254), H313 (= H323), D314 (= D324)
- binding calcium ion: N100 (= N113), D174 (= D182), Y208 (= Y216), L209 (= L217), E211 (= E219)
- binding magnesium ion: D19 (= D32), N21 (≠ D34), D23 (= D36), K25 (≠ I38), D27 (= D40)
5ykbD The n253f mutant structure of trehalose synthase from deinococcus radiodurans reveals an open active-site conformation (see paper)
53% identity, 49% coverage: 16:559/1107 of query aligns to 3:522/523 of 5ykbD
- active site: D96 (≠ E109), R178 (= R210), D180 (= D212), E222 (= E254), H289 (= H323), D290 (= D324)
- binding calcium ion: N100 (= N113), D150 (= D182), Y184 (= Y216), L185 (= L217), E187 (= E219)
- binding magnesium ion: D19 (= D32), N21 (≠ D34), D23 (= D36), K25 (≠ I38), D27 (= D40)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
32% identity, 46% coverage: 13:521/1107 of query aligns to 1:503/535 of 3wy2A
- active site: D97 (≠ E109), R197 (= R210), D199 (= D212), E268 (= E254), H329 (= H323), D330 (= D324)
- binding beta-D-glucopyranose: D59 (= D71), Y62 (= Y74), H102 (= H114), R197 (= R210), D199 (= D212), E268 (= E254), H329 (= H323), D330 (= D324), R397 (= R403)
- binding glycerol: S101 (≠ N113), D169 (= D182), V170 (≠ L183), P175 (= P188), R178 (≠ L191), Q179 (= Q192), F203 (vs. gap), Y204 (vs. gap), H206 (vs. gap), D240 (≠ N225), P244 (= P229), E280 (≠ D268)
- binding magnesium ion: D20 (= D32), R22 (≠ D34), V26 (≠ I38), D28 (= D40)
3wy1A Crystal structure of alpha-glucosidase (see paper)
32% identity, 46% coverage: 13:521/1107 of query aligns to 1:503/535 of 3wy1A
- active site: D97 (≠ E109), R197 (= R210), D199 (= D212), E268 (= E254), H329 (= H323), D330 (= D324)
- binding glycerol: S101 (≠ N113), D169 (= D182), V170 (≠ L183), F203 (vs. gap), Y204 (vs. gap), H206 (vs. gap)
- binding magnesium ion: D20 (= D32), D24 (= D36), V26 (≠ I38), D28 (= D40)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D71), Y62 (= Y74), H102 (= H114), F144 (≠ T157), F163 (= F176), R197 (= R210), D199 (= D212), T200 (≠ A213), G225 (vs. gap), E268 (= E254), F294 (= F282), H329 (= H323), D330 (= D324), R397 (= R403)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
32% identity, 46% coverage: 13:521/1107 of query aligns to 1:503/535 of 3wy4A
- active site: D97 (≠ E109), R197 (= R210), D199 (= D212), Q268 (≠ A253), H329 (= H323), D330 (= D324)
- binding alpha-D-glucopyranose: D59 (= D71), Y62 (= Y74), H102 (= H114), I143 (≠ D156), F163 (= F176), D199 (= D212), T200 (≠ A213), G225 (vs. gap), Q268 (≠ A253), Q268 (≠ A253), F294 (= F282), H329 (= H323), D330 (= D324), R397 (= R403), R397 (= R403)
- binding glycerol: S101 (≠ N113), D169 (= D182), V170 (≠ L183), F203 (vs. gap), Y204 (vs. gap), H206 (vs. gap), L224 (vs. gap), G225 (vs. gap), A226 (vs. gap), P227 (vs. gap), F294 (= F282), D330 (= D324), E374 (vs. gap), K395 (≠ G401), G396 (≠ D402), G399 (= G405)
- binding magnesium ion: D20 (= D32), D24 (= D36), V26 (≠ I38), D28 (= D40)
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
30% identity, 45% coverage: 16:518/1107 of query aligns to 3:509/546 of 8ibkA
- binding calcium ion: D19 (= D32), N21 (≠ D34), D23 (= D36), I25 (= I38), D27 (= D40)
- binding alpha-D-glucopyranose: D58 (= D71), Y61 (= Y74), H101 (= H114), I141 (= I153), F161 (= F176), D197 (= D212), A198 (= A213), H201 (≠ Y216), M227 (≠ E226), Q254 (≠ E254), Q254 (≠ E254), F280 (= F282), H320 (= H323), D321 (= D324), R405 (= R403)
Sites not aligning to the query:
5do8B 1.8 angstrom crystal structure of listeria monocytogenes lmo0184 alpha-1,6-glucosidase (see paper)
29% identity, 45% coverage: 16:516/1107 of query aligns to 4:513/553 of 5do8B
- active site: D97 (≠ E109), R193 (= R210), D195 (= D212), E252 (= E254), H325 (≠ R334), D326 (≠ E335)
- binding beta-D-glucopyranose: D59 (= D71), Y62 (= Y74), H102 (= H114), F159 (= F176), R193 (= R210), D195 (= D212), E252 (= E254), H325 (≠ R334), D326 (≠ E335), R411 (= R403)
2ze0A Alpha-glucosidase gsj (see paper)
31% identity, 45% coverage: 16:510/1107 of query aligns to 4:483/531 of 2ze0A
4wlcA Structure of dextran glucosidase with glucose (see paper)
31% identity, 46% coverage: 16:522/1107 of query aligns to 5:506/536 of 4wlcA
- active site: D98 (≠ E109), R192 (= R210), D194 (= D212), Q236 (≠ N256), H312 (≠ Y343), D313 (≠ A344)
- binding beta-D-glucopyranose: D60 (= D71), Y63 (= Y74), H103 (= H114), F158 (= F176), D194 (= D212), H312 (≠ Y343), D313 (≠ A344), R398 (= R403)
- binding calcium ion: D21 (= D32), N23 (≠ D34), D25 (= D36), I27 (= I38), D29 (= D40), D148 (≠ S166), D151 (≠ Q169)
2zidA Crystal structure of dextran glucosidase e236q complex with isomaltotriose (see paper)
31% identity, 46% coverage: 16:522/1107 of query aligns to 5:506/536 of 2zidA
- active site: D98 (≠ E109), R192 (= R210), D194 (= D212), Q236 (≠ N256), H312 (≠ Y343), D313 (≠ A344)
- binding calcium ion: D21 (= D32), N23 (≠ D34), D25 (= D36), I27 (= I38), D29 (= D40), D148 (≠ S166), D151 (≠ Q169)
- binding alpha-D-glucopyranose: D60 (= D71), Y63 (= Y74), H103 (= H114), F139 (= F154), F158 (= F176), D194 (= D212), V195 (≠ A213), Q236 (≠ N256), Q236 (≠ N256), W238 (= W258), K275 (≠ I300), H312 (≠ Y343), D313 (≠ A344), E371 (vs. gap), R398 (= R403), R398 (= R403)
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
30% identity, 45% coverage: 16:517/1107 of query aligns to 2:516/555 of 4m56A
- active site: D95 (≠ E109), R195 (= R210), D197 (= D212), E250 (= E254), H326 (≠ R334), D327 (≠ E335)
- binding D-glucose: D57 (= D71), Y60 (= Y74), H100 (= H114), F142 (≠ T157), D197 (= D212), E250 (= E254), D327 (≠ E335), R413 (= R403)
Query Sequence
>AZOBR_RS09450 FitnessBrowser__azobra:AZOBR_RS09450
MKNSDNGRIDRNDTLWYKDAVIYQLHVKAFFDADNDGIGDIAGLTQKLDYIQELGVTTLW
LLPFYPSPLRDDGYDIADYKAVNPSYGNLQDFKRFLRECHDRGLRVITELVINHTSDQHP
WFQRARQAKPGSNHRNFYVWSDTDQKYQGTRIIFCDTEKSNWTWDSEAQAYFWHRFYSHQ
PDLNFDNPKVLQEVLNVMRFWLDMGVDGLRLDAVPYLKEREGTNNENLPETHDVLKAIRT
EIDKGYGDRMLLAEANQWPEDVLPYFGDLEKGGDECHMAFHFPLMPRIYMAVAMEDRHPI
ADIMRQTPDIPDECQWAIFLRNHDELTLEMVTDRERDYLWDFYAADRRMRINLGIRRRLA
PLLQNDRRKIELLKSLLLSMPGTPVLYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGF
SRADPARLYLPAIQDPIYGFQAINVEAQQRSPSSLLNWMKRLIAVRQQHKAFGRGRFQLL
YPGNRKVLAYLRCHSTEEGDEVILCVANLSRSAQAVELDLKQFRGRVPVEMLGRTVFPPV
GDLPYLLTIPAYGFYWFALAAEAALPSWHETMPEPVPDLLTIVVRDGWQSLISGRAGEEL
ARDILQAYLPQQRWFAAKDRRIESAHIPMFARLNGPGDGFMMVRADVSLTGAKPQSYFLP
LAMSWEENAGNTGWPLLPFTLAKARRGPRTGAIYDAMQADAFTRSLLTALREGREVPASS
GHLRFSPTACMADLSVDDDTEIRRLGVEQSNSSILVGSQAVLKAFRRLTPGAHPELEVGR
FLTEVAGFQNTPPLLGSVEHVAEDGTPTALFVLQGYVRNQGDGWSSTVDSLVRDLDDIRL
GLSHDPEEPTEGEPFGMHAATMATLGQRTAELHCALAKRTGDPAFDPEPVTADDLKGWGE
AARRQAEAAFAALPGALDRLAPAVREQAESLLARRADVMNRLAELADTPPQGDKTRIHGD
YHLGQVLRAQNDWYIIDFEGEPAKSLEERRAKHSPLRDVAGMLRSFNYATWAALFRIDET
GVLEEAGAVMEAALDWERRSMQSFLEAYRAAMGACPDVPDGTTADRRLLALFLMEKALYE
IAYEAANRPNWIGIPVKGVLGLLDGES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory