Comparing AZOBR_RS09605 FitnessBrowser__azobra:AZOBR_RS09605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
42% identity, 96% coverage: 3:323/336 of query aligns to 9:328/336 of A3QCW5
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
32% identity, 92% coverage: 26:334/336 of query aligns to 4:308/310 of 7bbrA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
32% identity, 92% coverage: 26:334/336 of query aligns to 3:307/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
32% identity, 92% coverage: 26:334/336 of query aligns to 3:307/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
32% identity, 92% coverage: 26:334/336 of query aligns to 3:307/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
32% identity, 92% coverage: 26:334/336 of query aligns to 3:307/310 of 7bcnA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
32% identity, 91% coverage: 24:328/336 of query aligns to 3:302/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
32% identity, 91% coverage: 24:328/336 of query aligns to 2:301/303 of 4p9kA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
32% identity, 89% coverage: 29:327/336 of query aligns to 3:298/303 of 4pddA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
32% identity, 89% coverage: 30:328/336 of query aligns to 4:299/301 of 4pdhA
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
31% identity, 87% coverage: 31:323/336 of query aligns to 6:304/314 of 4p8bA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
31% identity, 82% coverage: 41:317/336 of query aligns to 17:290/304 of 4x8rA
Sites not aligning to the query:
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
30% identity, 84% coverage: 30:310/336 of query aligns to 4:280/304 of 4xeqB
7t3eA Structure of the sialic acid bound tripartite atp-independent periplasmic (trap) periplasmic component siap from photobacterium profundum (see paper)
30% identity, 84% coverage: 46:326/336 of query aligns to 25:297/300 of 7t3eA
Sites not aligning to the query:
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
32% identity, 82% coverage: 50:326/336 of query aligns to 24:293/300 of 4n8yA
Sites not aligning to the query:
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
29% identity, 89% coverage: 30:327/336 of query aligns to 4:297/301 of 4nq8B
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
31% identity, 82% coverage: 44:320/336 of query aligns to 18:291/305 of 4mnpA
4x04A Crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
31% identity, 80% coverage: 29:297/336 of query aligns to 3:272/301 of 4x04A
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
30% identity, 69% coverage: 24:255/336 of query aligns to 3:235/312 of 4oanA
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
29% identity, 78% coverage: 51:312/336 of query aligns to 25:281/302 of 4mijA
Sites not aligning to the query:
>AZOBR_RS09605 FitnessBrowser__azobra:AZOBR_RS09605
MKFVSLLCATVAAGCLMAATAATAQEPIVIKFSHVVAPETPKGKGAEKFKQLAEQRTAGK
VKVEVYPNSQLYKDKEELEALQLGAVQMLAPSLAKFGPLGAKEFEIFDLPYIFPCKTALV
KVTTGPIGKQLFQKLENKGITGLAYWDNGFKIMSANKPLHATADFKGLKMRIQSSKVLDA
QMRALGALPQVMAFSEVYQALQTGVVDGTENPPSNMYTQKMHEVQSHATLSDHGYLGYAV
IVNKKFWDGLPADVRTQLDGAMKEATEYANNIAQEENDKALEAMKAAGKTKFYELTKDER
ASWRQAMLPVHEDMASRVGKELLASIKTETDAAKCE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory