SitesBLAST
Comparing AZOBR_RS09675 AZOBR_RS09675 glucosamine--fructose-6-phosphate aminotransferase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
50% identity, 100% coverage: 2:608/608 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99), Y248 (= Y249), E481 (= E480), K485 (= K484), E488 (= E487), H504 (= H503), K603 (= K603)
- binding glucose-6-phosphate: T302 (= T301), S347 (= S346), Q348 (= Q347), S349 (= S348), T352 (= T351), V399 (= V397), S401 (= S399), E488 (= E487)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N98), G99 (= G99), D123 (= D123)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
50% identity, 100% coverage: 2:608/608 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99), Y248 (= Y249), E481 (= E480), K485 (= K484), E488 (= E487), H504 (= H503), K603 (= K603)
- binding fructose -6-phosphate: G301 (= G300), T302 (= T301), S303 (≠ A302), S347 (= S346), Q348 (= Q347), S349 (= S348), T352 (= T351), S401 (= S399), K485 (= K484), E488 (= E487)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
50% identity, 100% coverage: 2:608/608 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99), Y248 (= Y249), E481 (= E480), K485 (= K484), E488 (= E487), H504 (= H503), K603 (= K603)
- binding glucose-6-phosphate: T302 (= T301), S303 (≠ A302), S347 (= S346), Q348 (= Q347), S349 (= S348), T352 (= T351), S401 (= S399), K485 (= K484), E488 (= E487)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
39% identity, 100% coverage: 2:608/608 of query aligns to 1:660/660 of 6svmA
- active site: L7 (≠ I8), R32 (= R27), W95 (= W74), N122 (= N98), G123 (= G99), E533 (= E480), K537 (= K484), E540 (= E487), H556 (= H503), K655 (= K603)
- binding glucose-6-phosphate: C353 (= C299), T355 (= T301), S356 (≠ A302), S400 (= S346), Q401 (= Q347), S402 (= S348), T405 (= T351), S453 (= S399), K537 (= K484), E540 (= E487)
- binding glutamic acid: C1 (= C2), R94 (= R73), W95 (= W74), T97 (= T76), H107 (= H86), G123 (= G99), D147 (= D123)
- binding magnesium ion: S434 (≠ A380), R435 (= R381), T437 (≠ S383)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (≠ A238), R322 (≠ Y271), G334 (vs. gap), G424 (≠ S370), T426 (≠ V372), S434 (≠ A380), T437 (≠ S383), C439 (≠ A385), G440 (≠ V386), V441 (≠ L387), H442 (≠ Y388)
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
38% identity, 100% coverage: 2:608/608 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (≠ I8), R32 (= R27), W95 (= W74), N122 (= N98), G123 (= G99), E536 (= E480), K540 (= K484), E543 (= E487), H559 (= H503), K658 (= K603)
- binding glucose-6-phosphate: T358 (= T301), S359 (≠ A302), S403 (= S346), Q404 (= Q347), S405 (= S348), T408 (= T351), S456 (= S399), K540 (= K484), E543 (= E487)
- binding glutamic acid: C1 (= C2), R94 (= R73), W95 (= W74), T97 (= T76), G123 (= G99), D147 (= D123)
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
38% identity, 99% coverage: 2:601/608 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (≠ I8), R32 (= R27), W95 (= W74), N122 (= N98), G123 (= G99), E532 (= E480), K536 (= K484), E539 (= E487), H555 (= H503)
- binding glucose-6-phosphate: G353 (= G300), T354 (= T301), S355 (≠ A302), S399 (= S346), Q400 (= Q347), S401 (= S348), T404 (= T351), S452 (= S399), E539 (= E487)
- binding magnesium ion: S433 (≠ A380), R434 (= R381), T436 (≠ S383)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (≠ A238), R321 (≠ Y271), G333 (vs. gap), G423 (≠ S370), T425 (≠ V372), S433 (≠ A380), T436 (≠ S383), C438 (≠ A385), G439 (≠ V386), V440 (≠ L387), H441 (≠ Y388)
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
37% identity, 100% coverage: 1:608/608 of query aligns to 1:699/699 of Q06210
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
52% identity, 59% coverage: 249:608/608 of query aligns to 7:367/367 of 1mosA
- active site: E240 (= E480), K244 (= K484), E247 (= E487), H263 (= H503), K362 (= K603)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T301), S62 (≠ A302), S106 (= S346), Q107 (= Q347), S108 (= S348), T111 (= T351), K244 (= K484), E247 (= E487)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
52% identity, 59% coverage: 249:608/608 of query aligns to 6:366/366 of 1morA
- active site: E239 (= E480), K243 (= K484), E246 (= E487), H262 (= H503), K361 (= K603)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T301), S105 (= S346), Q106 (= Q347), S107 (= S348), T110 (= T351), V157 (= V397), A360 (= A602), K361 (= K603)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
52% identity, 59% coverage: 249:608/608 of query aligns to 6:366/366 of 1moqA
- active site: E239 (= E480), K243 (= K484), E246 (= E487), H262 (= H503), K361 (= K603)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T301), S61 (≠ A302), S105 (= S346), Q106 (= Q347), S107 (= S348), T110 (= T351), V157 (= V397), A360 (= A602), K361 (= K603)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
51% identity, 58% coverage: 249:599/608 of query aligns to 6:357/357 of 7dnrA
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
43% identity, 60% coverage: 246:608/608 of query aligns to 2:365/365 of 2zj4A
- active site: E238 (= E480), K242 (= K484), E245 (= E487), H261 (= H503), K360 (= K603)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T301), S61 (≠ A302), S105 (= S346), Q106 (= Q347), S107 (= S348), T110 (= T351), V156 (= V397), A157 (= A398), K242 (= K484), E245 (= E487)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
43% identity, 60% coverage: 246:608/608 of query aligns to 2:365/365 of 2zj3A
- active site: E238 (= E480), K242 (= K484), E245 (= E487), H261 (= H503), K360 (= K603)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T301), S61 (≠ A302), S105 (= S346), Q106 (= Q347), S107 (= S348), T110 (= T351), V156 (= V397), A359 (= A602), K360 (= K603)
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
40% identity, 71% coverage: 176:608/608 of query aligns to 281:717/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
41% identity, 58% coverage: 246:596/608 of query aligns to 1:352/352 of 2v4mA
- active site: E237 (= E480), K241 (= K484), E244 (= E487), H260 (= H503)
- binding fructose -6-phosphate: T59 (= T301), S60 (≠ A302), S104 (= S346), Q105 (= Q347), S106 (= S348), T109 (= T351), A156 (= A398), S157 (= S399), K241 (= K484), E244 (= E487)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
38% identity, 57% coverage: 249:596/608 of query aligns to 2:352/352 of 2pocB
- active site: E236 (= E480), K240 (= K484), E243 (= E487), H259 (= H503)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C299), T57 (= T301), S58 (≠ A302), S102 (= S346), Q103 (= Q347), S104 (= S348), T107 (= T351), E243 (= E487)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ Y271), G36 (≠ E283), G126 (≠ S370), V128 (= V372), S136 (≠ A380), T139 (≠ S383), C141 (≠ A385), G142 (≠ V386), V143 (≠ L387), H144 (≠ Y388)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
36% identity, 57% coverage: 249:596/608 of query aligns to 2:339/339 of 2putA
- active site: E236 (= E480), K240 (= K484), E243 (= E487)
- binding fructose -6-phosphate: C55 (= C299), T57 (= T301), S102 (= S346), Q103 (= Q347), S104 (= S348), T107 (= T351), A154 (= A398), S155 (= S399), K240 (= K484)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ Y271), G36 (≠ E283), G126 (≠ S370), V128 (= V372), S136 (≠ A380), T139 (≠ S383), C141 (≠ A385), G142 (≠ V386), V143 (≠ L387), H144 (≠ Y388)
2puwB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
36% identity, 57% coverage: 249:596/608 of query aligns to 2:331/331 of 2puwB
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
50% identity, 38% coverage: 2:232/608 of query aligns to 1:231/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N98), G99 (= G99), D123 (= D123)
1xffA Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate (see paper)
50% identity, 38% coverage: 2:232/608 of query aligns to 1:231/238 of 1xffA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99)
- binding glutamic acid: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N98), G99 (= G99), D123 (= D123)
Query Sequence
>AZOBR_RS09675 AZOBR_RS09675 glucosamine--fructose-6-phosphate aminotransferase
MCGIIGIIGTHDAAPRLVEGLRRLEYRGYDSAGVATLVKGGIERRRAEGKLINLDAKLRE
APLPGVIGIGHTRWATHGGPTENNAHPHATHRVAVVHNGIIENYQELKTELIEHGYVFES
ATDTEVIAHLVTYYMEKEGLGPVEAAAASFKRFTGAFSLVLLFSGQEDMLIGARHGTPLA
VGYGEGEMYFASDAFALAPLTNRICYLEDGDWVELTRTAAVIHDATDAVVERPVKTTALS
GALIGKDGYRHYMLKEIYEQPQVIGDTLNAYINPETGRVTLPETSFDIAKATKLTIVACG
TAYYAGVVAKYWFETLARLPVEVDIASEFRYREAPLPEGGVALFISQSGETLDTLEALRY
CKRQGQKILSIVNVPESTIARESDAVLYTMAGPEIGVASTKAFTTQLTTLACLAVTVGHA
RGVIPAERMQQIAQALREVPARAADVLAHDERLHELAQEVAEARDVLYLGRGAMYPLALE
GALKLKEISYIHAEGYAAGELKHGPIALIDESVPVIVLVPSDNLFEKTVSNVQEVCARSG
KVLLIADKKGIDKLSDKVRWSLELPACDPLVAPLLYAIPVQLLAYHVAVLKGTDVDQPRN
LAKSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory