SitesBLAST
Comparing AZOBR_RS09745 FitnessBrowser__azobra:AZOBR_RS09745 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dnaA Crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021
52% identity, 99% coverage: 4:447/450 of query aligns to 2:449/461 of 4dnaA
- active site: Y37 (≠ V39), C41 (= C43), C46 (= C48), K49 (= K51), Y178 (= Y177), E182 (= E181), A435 (= A433), H437 (= H435), E442 (= E440)
- binding flavin-adenine dinucleotide: I9 (= I11), G10 (= G12), G11 (≠ A13), G12 (= G14), G14 (= G16), E33 (= E35), E34 (≠ G36), G39 (= G41), T40 (= T42), C41 (= C43), G45 (= G47), C46 (= C48), K49 (= K51), R112 (≠ F114), A113 (≠ G115), V139 (≠ T139), G140 (= G140), Y178 (= Y177), R264 (= R262), G303 (= G301), D304 (= D302), Q310 (≠ A308), L311 (= L309), T312 (= T310)
Sites not aligning to the query:
3o0hB Crystal structure of glutathione reductase from bartonella henselae
47% identity, 98% coverage: 4:445/450 of query aligns to 2:445/459 of 3o0hB
- active site: S13 (= S15), I37 (≠ V39), C41 (= C43), C46 (= C48), K49 (= K51), D74 (≠ M76), P75 (= P77), Y177 (= Y177), E181 (= E181), I314 (= I314), A433 (= A433), H435 (= H435), E440 (= E440)
- binding flavin-adenine dinucleotide: I9 (= I11), G10 (= G12), G12 (= G14), S13 (= S15), G14 (= G16), A32 (≠ C34), E33 (= E35), E34 (≠ G36), T40 (= T42), C41 (= C43), G45 (= G47), C46 (= C48), K49 (= K51), R112 (≠ F114), A113 (≠ G115), T139 (= T139), G140 (= G140), Y177 (= Y177), R262 (= R262), N265 (= N265), G301 (= G301), D302 (= D302), Q308 (≠ A308), L309 (= L309), T310 (= T310)
Sites not aligning to the query:
P28593 Trypanothione reductase; TR; N(1),N(8)-bis(glutathionyl)spermidine reductase; EC 1.8.1.12 from Trypanosoma cruzi (see paper)
43% identity, 98% coverage: 6:446/450 of query aligns to 6:472/492 of P28593
- C53 (= C43) modified: Disulfide link with 58, Redox-active
- C58 (= C48) modified: Disulfide link with 53, Redox-active
1bzlA Crystal structure of trypanosoma cruzi trypanothione reductase in complex with trypanothione, and the structure-based discovery of new natural product inhibitors (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 5:471/486 of 1bzlA
- active site: S14 (= S15), L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), R85 (vs. gap), T86 (= T74), F198 (≠ Y177), E202 (= E181), I338 (= I314), G458 (≠ A433), H460 (= H435), E465 (= E440)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), S14 (= S15), G15 (= G16), D35 (vs. gap), S46 (= S37), G50 (= G41), T51 (= T42), C52 (= C43), V55 (≠ R46), G56 (= G47), C57 (= C48), K60 (= K51), G127 (= G115), S160 (≠ T139), G161 (= G140), R287 (= R262), R290 (≠ N265), G325 (= G301), D326 (= D302), M332 (≠ A308), L333 (= L309), T334 (= T310)
- binding bis(gamma-glutamyl-cysteinyl-glycinyl)spermidine: L17 (≠ V18), E18 (≠ A19), V58 (= V49), S109 (≠ I98), Y110 (= Y99), I338 (= I314), F395 (= F371), P397 (= P373), G458 (≠ A433), H460 (= H435), T462 (≠ S437), E465 (= E440)
Sites not aligning to the query:
4newA Crystal structure of trypanothione reductase from trypanosoma cruzi in complex with inhibitor ep127 (5-{5-[1-(pyrrolidin-1-yl)cyclohexyl]-1, 3-thiazol-2-yl}-1h-indole) (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 1:467/482 of 4newA
- binding 5-{5-[1-(pyrrolidin-1-yl)cyclohexyl]-1,3-thiazol-2-yl}-1H-indole: W17 (≠ R22), S105 (≠ I98), M109 (= M102)
- binding flavin-adenine dinucleotide: I6 (= I11), G7 (= G12), G9 (= G14), S10 (= S15), G11 (= G16), I30 (vs. gap), D31 (vs. gap), V32 (= V31), S42 (= S37), G46 (= G41), T47 (= T42), C48 (= C43), G52 (= G47), C53 (= C48), K56 (= K51), G123 (= G115), A155 (= A138), S156 (≠ T139), G157 (= G140), I195 (= I178), R283 (= R262), R286 (≠ N265), G321 (= G301), D322 (= D302), M328 (≠ A308), L329 (= L309), T330 (= T310)
1gxfA Crystal structure of trypanosoma cruzi trypanothione reductase in complex with the inhibitor quinacrine mustard (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 3:469/484 of 1gxfA
- active site: S12 (= S15), L46 (≠ V39), C50 (= C43), C55 (= C48), K58 (= K51), R83 (vs. gap), T84 (= T74), F196 (≠ Y177), E200 (= E181), I336 (= I314), G456 (≠ A433), H458 (= H435), E463 (= E440)
- binding flavin-adenine dinucleotide: I8 (= I11), G11 (= G14), D33 (vs. gap), V34 (= V31), S44 (= S37), G48 (= G41), T49 (= T42), G54 (= G47), C55 (= C48), K58 (= K51), G125 (= G115), S158 (≠ T139), R285 (= R262), R288 (≠ N265), G323 (= G301), D324 (= D302), M330 (≠ A308), L331 (= L309), T332 (= T310)
- binding quinacrine mustard: L15 (≠ V18), E16 (≠ A19), W19 (≠ R22), C50 (= C43), S107 (≠ I98), S107 (≠ I98), Y108 (= Y99), Y108 (= Y99), E110 (≠ K101), M111 (= M102), D114 (≠ N105), I336 (= I314)
Sites not aligning to the query:
6i7nB Trypanothione reductase from leismania infantum in complex with trl156 (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 5:472/488 of 6i7nB
- active site: C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y177), E202 (= E181), H461 (= H435), E466 (= E440)
- binding flavin-adenine dinucleotide: G11 (= G12), G15 (= G16), D35 (≠ E35), A46 (≠ S37), A47 (≠ R38), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), G127 (= G115), A159 (= A138), T160 (= T139), G161 (= G140), Y198 (= Y177), R287 (= R262), G326 (= G301), D327 (= D302), M333 (≠ A308), L334 (= L309), T335 (= T310)
- binding ~{N}-(4-azanylbutyl)-~{N}-(2-azanyl-2-oxidanylidene-ethyl)-7-(3-azanyl-3-oxidanylidene-propyl)-4-(dimethylamino)-2-(2-naphthalen-2-ylethylamino)pyrrolo[2,3-d]pyrimidine-6-carboxamide: L17 (≠ V18), E18 (≠ A19), Y110 (= Y99)
Sites not aligning to the query:
6er5A X-ray structure of trypanothione reductase from leishmania infantum in complex with 2-(diethylamino)ethyl 4-((3-(4-nitrophenyl)-3- oxopropyl)amino)benzoate (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 5:472/488 of 6er5A
- active site: C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y177), E202 (= E181), H461 (= H435), E466 (= E440)
- binding 2-(diethylamino)ethyl 4-((3-(4-nitrophenyl)-3-oxopropyl)amino)benzoate: Y221 (≠ I197), R222 (= R198), R228 (≠ N204), I285 (≠ T260)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), G15 (= G16), V34 (≠ C34), D35 (≠ E35), V36 (vs. gap), A46 (≠ S37), A47 (≠ R38), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), G127 (= G115), T160 (= T139), Y198 (= Y177), R287 (= R262), R290 (≠ N265), G326 (= G301), D327 (= D302), M333 (≠ A308), L334 (= L309), T335 (= T310)
Sites not aligning to the query:
4apnA Structure of tr from leishmania infantum in complex with a diarylpirrole-based inhibitor (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 5:472/488 of 4apnA
- active site: L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y177), E202 (= E181), G459 (≠ A433), H461 (= H435), E466 (= E440)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), S14 (= S15), D35 (≠ E35), A46 (≠ S37), G50 (= G41), T51 (= T42), G56 (= G47), C57 (= C48), K60 (= K51), G127 (= G115), T160 (= T139), R287 (= R262), R290 (≠ N265), G326 (= G301), D327 (= D302), L334 (= L309), T335 (= T310)
- binding 4-[[1-(4-ethylphenyl)-2-methyl-5-(4-methylsulfanylphenyl)pyrrol-3-yl]methyl]thiomorpholine: L17 (≠ V18), E18 (≠ A19), S109 (≠ I98), Y110 (= Y99), M113 (= M102), F396 (= F371), T397 (≠ R372)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G196 (= G175), G197 (= G176), Y198 (= Y177), I199 (= I178), E202 (= E181), Y221 (≠ I197), R222 (= R198), R228 (≠ N204), A284 (= A259), I285 (≠ T260), G286 (= G261), R287 (= R262), M333 (≠ A308), A365 (= A340)
Sites not aligning to the query:
4adwA Crystal structure of leishmania infantum trypanothione reductase in complex with NADPH and trypanothione (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 5:472/488 of 4adwA
- active site: L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y177), E202 (= E181), G459 (≠ A433), H461 (= H435), E466 (= E440)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), S14 (= S15), G15 (= G16), D35 (≠ E35), A46 (≠ S37), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), G127 (= G115), A159 (= A138), T160 (= T139), R287 (= R262), R290 (≠ N265), G326 (= G301), D327 (= D302), M333 (≠ A308), L334 (= L309), T335 (= T310), H461 (= H435), P462 (= P436)
- binding bis(gamma-glutamyl-cysteinyl-glycinyl)spermidine: F396 (= F371), L399 (≠ M374), H461 (= H435), E466 (= E440)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G196 (= G175), G197 (= G176), Y198 (= Y177), I199 (= I178), Y221 (≠ I197), R222 (= R198), R228 (≠ N204), I285 (≠ T260), G286 (= G261), R287 (= R262), A365 (= A340)
Sites not aligning to the query:
2yauA X-ray structure of the leishmania infantum tryopanothione reductase in complex with auranofin (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 5:472/488 of 2yauA
- active site: L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y177), E202 (= E181), G459 (≠ A433), H461 (= H435), E466 (= E440)
- binding gold ion: C52 (= C43), C57 (= C48), T335 (= T310)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), G15 (= G16), D35 (≠ E35), V36 (vs. gap), A46 (≠ S37), A47 (≠ R38), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), F126 (= F114), G127 (= G115), A159 (= A138), T160 (= T139), R287 (= R262), R290 (≠ N265), D327 (= D302), L334 (= L309), T335 (= T310)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G196 (= G175), G197 (= G176), Y198 (= Y177), I199 (= I178), E202 (= E181), Y221 (≠ I197), R222 (= R198), R228 (≠ N204), I285 (≠ T260), G286 (= G261), R287 (= R262), M333 (≠ A308), A365 (= A340)
- binding 2,3,4,6-tetra-O-acetyl-1-thio-beta-D-glucopyranose: F396 (= F371), L399 (≠ M374), H461 (= H435)
Sites not aligning to the query:
2x50A Crystal structure of trypanothione reductase from leishmania infantum in complex with NADPH and silver (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 4:471/485 of 2x50A
- active site: L47 (≠ V39), C51 (= C43), C56 (= C48), K59 (= K51), Y197 (= Y177), E201 (= E181), G458 (≠ A433), H460 (= H435), E465 (= E440)
- binding silver ion: C51 (= C43), C56 (= C48), T334 (= T310)
- binding flavin-adenine dinucleotide: G12 (= G14), S13 (= S15), V33 (≠ C34), D34 (≠ E35), A45 (≠ S37), G49 (= G41), T50 (= T42), C51 (= C43), G55 (= G47), C56 (= C48), K59 (= K51), G126 (= G115), T159 (= T139), R286 (= R262), R289 (≠ N265), G325 (= G301), D326 (= D302), L333 (= L309), T334 (= T310)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G195 (= G175), G196 (= G176), Y197 (= Y177), I198 (= I178), E201 (= E181), Y220 (≠ I197), R221 (= R198), R227 (≠ N204), A283 (= A259), I284 (≠ T260), G285 (= G261), R286 (= R262), M332 (≠ A308), A364 (= A340)
Sites not aligning to the query:
2w0hA X ray structure of leishmania infantum trypanothione reductase in complex with antimony and NADPH (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 4:471/485 of 2w0hA
- active site: L47 (≠ V39), C51 (= C43), C56 (= C48), K59 (= K51), Y197 (= Y177), E201 (= E181), G458 (≠ A433), H460 (= H435), E465 (= E440)
- binding flavin-adenine dinucleotide: G10 (= G12), G12 (= G14), S13 (= S15), G14 (= G16), V33 (≠ C34), D34 (≠ E35), A45 (≠ S37), G49 (= G41), T50 (= T42), C51 (= C43), G55 (= G47), C56 (= C48), K59 (= K51), G126 (= G115), T159 (= T139), R286 (= R262), R289 (≠ N265), G325 (= G301), D326 (= D302), L333 (= L309), T334 (= T310)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G195 (= G175), G196 (= G176), Y197 (= Y177), I198 (= I178), E201 (= E181), Y220 (≠ I197), R221 (= R198), R227 (≠ N204), N253 (≠ Q230), A283 (= A259), I284 (≠ T260), G285 (= G261), R286 (= R262), M332 (≠ A308), A364 (= A340)
- binding antimony (iii) ion: C51 (= C43), C56 (= C48), T334 (= T310)
Sites not aligning to the query:
5ebkA Trypanothione reductase in complex with 6-(sec-butoxy)-2-((3- chlorophenyl)thio)pyrimidin-4-amine (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 5:472/486 of 5ebkA
- active site: L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y177), E202 (= E181), G459 (≠ A433), H461 (= H435), E466 (= E440)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), S14 (= S15), D35 (≠ E35), V36 (vs. gap), A46 (≠ S37), A47 (≠ R38), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), K60 (= K51), G127 (= G115), A159 (= A138), T160 (= T139), G161 (= G140), S178 (= S157), Y198 (= Y177), R287 (= R262), R290 (≠ N265), G326 (= G301), D327 (= D302), M333 (≠ A308), L334 (= L309), T335 (= T310), A338 (= A313)
- binding 6-sec-Butoxy-2-[(3-chlorophenyl)sulfanyl]-4-pyrimidinamine: C52 (= C43), V53 (= V44), Y110 (= Y99), Y221 (≠ I197), R222 (= R198), R222 (= R198), D224 (≠ E200), R228 (≠ N204), N252 (≠ R228), N254 (≠ Q230), I285 (≠ T260), H461 (= H435), E466 (= E440)
Sites not aligning to the query:
6t98A Trypanothione reductase from leishmania infantum in complex with 9a (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 6:473/489 of 6t98A
- active site: C53 (= C43), C58 (= C48), K61 (= K51), Y199 (= Y177), E203 (= E181), H462 (= H435), E467 (= E440)
- binding flavin-adenine dinucleotide: G12 (= G12), G14 (= G14), S15 (= S15), G16 (= G16), V35 (≠ C34), D36 (≠ E35), A47 (≠ S37), G51 (= G41), T52 (= T42), C53 (= C43), G57 (= G47), C58 (= C48), K61 (= K51), G128 (= G115), T161 (= T139), Y199 (= Y177), I200 (= I178), R288 (= R262), R291 (≠ N265), G327 (= G301), D328 (= D302), M334 (≠ A308), L335 (= L309), T336 (= T310)
- binding 4-[3-methyl-1-[4-[4-(2-phenylethyl)-1,3-thiazol-2-yl]-3-(2-piperidin-4-ylethoxy)phenyl]-1,2,3-triazol-3-ium-4-yl]butan-1-amine: W22 (≠ R22), S106 (≠ R94), S110 (≠ I98), M114 (= M102), D117 (≠ N105)
Sites not aligning to the query:
6t97A Trypanothione reductase from leismania infantum in complex with trl190
42% identity, 98% coverage: 6:446/450 of query aligns to 6:473/489 of 6t97A
- active site: C53 (= C43), C58 (= C48), K61 (= K51), Y199 (= Y177), E203 (= E181), H462 (= H435), E467 (= E440)
- binding flavin-adenine dinucleotide: G12 (= G12), G14 (= G14), S15 (= S15), G16 (= G16), V35 (≠ C34), D36 (≠ E35), A47 (≠ S37), A48 (≠ R38), T52 (= T42), C53 (= C43), G57 (= G47), C58 (= C48), K61 (= K51), G128 (= G115), T161 (= T139), G162 (= G140), Y199 (= Y177), I200 (= I178), R288 (= R262), R291 (≠ N265), G327 (= G301), D328 (= D302), M334 (≠ A308), L335 (= L309), T336 (= T310)
- binding 4-[1-[4-[4-(2-phenylethyl)-1,3-thiazol-2-yl]-3-(2-piperidin-4-ylethoxy)phenyl]-1,2,3-triazol-4-yl]butan-1-amine: E19 (≠ A19), W22 (≠ R22), S106 (≠ R94), S110 (≠ I98), Y111 (= Y99), M114 (= M102), D117 (≠ N105)
Sites not aligning to the query:
6t95A Trypanothione reductase from leismania infantum in complex with 4a (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 6:473/489 of 6t95A
- active site: C53 (= C43), C58 (= C48), K61 (= K51), Y199 (= Y177), E203 (= E181), H462 (= H435), E467 (= E440)
- binding flavin-adenine dinucleotide: G12 (= G12), G14 (= G14), S15 (= S15), G16 (= G16), D36 (≠ E35), V37 (vs. gap), A47 (≠ S37), A48 (≠ R38), G51 (= G41), T52 (= T42), C53 (= C43), G57 (= G47), C58 (= C48), K61 (= K51), G128 (= G115), T161 (= T139), G162 (= G140), Y199 (= Y177), R288 (= R262), R291 (≠ N265), G327 (= G301), D328 (= D302), M334 (≠ A308), L335 (= L309), T336 (= T310)
- binding 1-[2-[5-[4-(4-azanylbutyl)-3-methyl-1,2,3-triazol-3-ium-1-yl]-2-[4-(2-phenylethyl)-1,3-thiazol-2-yl]phenoxy]ethyl]imidazolidin-2-one: E19 (≠ A19), W22 (≠ R22), S106 (≠ R94), I107 (≠ L95), S110 (≠ I98), Y111 (= Y99), M114 (= M102), D117 (≠ N105)
Sites not aligning to the query:
6i7nA Trypanothione reductase from leismania infantum in complex with trl156 (see paper)
42% identity, 98% coverage: 6:446/450 of query aligns to 6:473/490 of 6i7nA
- active site: C53 (= C43), C58 (= C48), K61 (= K51), Y199 (= Y177), E203 (= E181), H462 (= H435), E467 (= E440)
- binding flavin-adenine dinucleotide: G12 (= G12), G14 (= G14), S15 (= S15), G16 (= G16), D36 (≠ E35), A47 (≠ S37), A48 (≠ R38), G51 (= G41), T52 (= T42), C53 (= C43), G57 (= G47), C58 (= C48), K61 (= K51), G128 (= G115), A160 (= A138), T161 (= T139), G162 (= G140), R288 (= R262), D328 (= D302), L335 (= L309), T336 (= T310), A339 (= A313)
Sites not aligning to the query:
D0VWY5 Glutathione amide reductase; GAR; EC 1.8.1.16 from Marichromatium gracile (Chromatium gracile) (see 2 papers)
42% identity, 99% coverage: 6:449/450 of query aligns to 5:451/463 of D0VWY5
- SG 14:15 (= SG 15:16) binding
- E34 (= E35) binding
- T41 (= T42) binding
- C42 (= C43) modified: Disulfide link with 47, Redox-active
- C47 (= C48) modified: Disulfide link with 42, Redox-active
- K50 (= K51) binding ; binding
- HA 113:114 (≠ FG 114:115) binding
- 174:180 (vs. 175:181, 57% identical) binding
- LE 197:198 (≠ RG 198:199) binding
- V230 (≠ P231) binding
- G261 (= G261) binding
- D302 (= D302) binding
- Q308 (≠ A308) binding
- QLT 308:310 (≠ ALT 308:310) binding
- V341 (≠ A340) binding
- H437 (= H435) active site, Proton acceptor; binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 binding
- 2:463 modified: mature protein, Glutathione amide reductase
- 3 binding
- 4 binding
2rabA Structure of glutathione amide reductase from chromatium gracile in complex with NAD (see paper)
42% identity, 99% coverage: 6:449/450 of query aligns to 4:447/451 of 2rabA
- active site: S13 (= S15), L37 (≠ V39), C41 (= C43), C46 (= C48), K49 (= K51), Y173 (= Y177), E177 (= E181), I310 (= I314), A431 (= A433), H433 (= H435), E438 (= E440)
- binding flavin-adenine dinucleotide: G10 (= G12), G12 (= G14), S13 (= S15), G14 (= G16), I32 (≠ C34), E33 (= E35), S34 (≠ G36), T40 (= T42), G45 (= G47), C46 (= C48), K49 (= K51), H110 (≠ F114), A111 (≠ G115), T135 (= T139), G136 (= G140), R258 (= R262), G297 (= G301), D298 (= D302), Q304 (≠ A308), L305 (= L309), T306 (= T310)
- binding nicotinamide-adenine-dinucleotide: K49 (= K51), I169 (≠ L173), G172 (= G176), Y173 (= Y177), I174 (= I178), E177 (= E181), A193 (≠ I197), L194 (≠ R198), E195 (≠ G199), V227 (≠ P231), V256 (≠ T260), G257 (= G261), Q304 (≠ A308), V337 (≠ A340)
Query Sequence
>AZOBR_RS09745 FitnessBrowser__azobra:AZOBR_RS09745
VAEFDFDLFTIGAGSGGVAASRRAAAMGAKVAICEGSRVGGTCVIRGCVPKKLLVYAAQF
RDAFEDSSAYGWSTTMPAFDWATLIGRKDAEIDRLNGIYIKMLENSGVTLHTGFGRLIDR
HTVEVANQRYTAKNILVATGGWPALPKIPGIEHAVTSNEALQLGTLPHSVIILGGGYIAV
EFAGIFRGLGAEVTIMIRGEELLNGFDDDIRVALAQEMRKRGITILTRTQPVKVEDGPGG
FTVTDQLGREHSAGLVMAATGRRPNTRDLGLEAAGVALDDAGAIRVDEYSRTSVDNIFAV
GDVTDRMALTPVAIAEGRAFVETLFNDNPTSISYANIPTAVFSIPPLGTVGLTEAEARAK
FATVDIYKAGFRPMKHTMSGRDERVLMKLVVDGESQRVLGCHMMGMDAPEIVQGLGIALN
CGATKRDFDRTIALHPSTAEEFVLMREKVS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory