SitesBLAST
Comparing AZOBR_RS09940 FitnessBrowser__azobra:AZOBR_RS09940 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4gljA Crystal structure of methylthioadenosine phosphorylase in complex with rhodamine b (see paper)
50% identity, 89% coverage: 10:272/294 of query aligns to 6:269/287 of 4gljA
- active site: D212 (= D213), D214 (= D215)
- binding N-[9-(2-carboxyphenyl)-6-(diethylamino)-3H-xanthen-3-ylidene]-N-ethylethanaminium: S12 (= S16), Y15 (= Y19), H55 (= H59), A88 (= A92), G90 (= G94), F169 (= F170), F169 (= F170), I186 (= I187), G187 (= G188), M188 (= M189), D212 (= D213), F213 (= F214), D214 (= D215), N219 (≠ E220), A228 (≠ V229), I229 (= I230), L232 (≠ V233)
3t94A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase (mtap) ii complexed with 5'-deoxy-5'-methylthioadenosine and sulfate (see paper)
46% identity, 92% coverage: 1:271/294 of query aligns to 1:270/270 of 3t94A
- active site: S16 (= S16), P39 (= P39), H63 (= H63), I65 (= I65), P66 (= P66), A92 (= A92), M190 (= M189), T191 (= T190), D214 (= D213), D216 (= D215), A225 (≠ V226)
- binding 5'-deoxy-5'-methylthioadenosine: G94 (= G94), F170 (= F170), I188 (= I187), M190 (= M189), D214 (= D213), A225 (≠ V226), V228 (= V229)
Q97W94 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; MTAPII; EC 2.4.2.28 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
46% identity, 92% coverage: 1:271/294 of query aligns to 1:270/270 of Q97W94
- C138 (= C138) modified: Disulfide link with 205
- C200 (≠ R199) modified: Disulfide link with 262
- C205 (= C204) modified: Disulfide link with 138
- C259 (= C258) modified: Disulfide link with 261; mutation to S: Reduces thermostability of the enzyme; when associated with S-261.
- C261 (= C262) modified: Disulfide link with 259; mutation to S: Reduces thermostability of the enzyme; when associated with S-259.
- C262 (≠ H263) modified: Disulfide link with 200; mutation to S: Reduces thermostability of the enzyme.
1wtaA Crystal structure of 5'-deoxy-5'-methylthioadenosine from aeropyrum pernix (r32 form)
49% identity, 88% coverage: 10:269/294 of query aligns to 12:271/273 of 1wtaA
6dz0A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((pent-4-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
43% identity, 84% coverage: 6:251/294 of query aligns to 2:252/274 of 6dz0A
- active site: T12 (≠ S16), P35 (= P39), H59 (= H63), I61 (= I65), M62 (≠ P66), A88 (= A92), M190 (= M189), T191 (= T190), D214 (= D213), D216 (= D215), V227 (= V226)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(pent-4-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T12 (≠ S16), H59 (= H63), A88 (= A92), C89 (≠ V93), G90 (= G94), F171 (= F170), I188 (= I187), N189 (≠ G188), M190 (= M189), T213 (= T212), D214 (= D213), D216 (= D215), V227 (= V226), V230 (= V229)
- binding phosphate ion: G11 (= G15), T12 (≠ S16), R54 (= R58), H55 (= H59), T87 (≠ S91), T191 (= T190)
6dz3A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-(((3-(1-butyl-1h-1,2,3-triazol-4-yl) propyl)thio)methyl)pyrrolidin-3-ol (see paper)
44% identity, 82% coverage: 10:251/294 of query aligns to 4:250/273 of 6dz3A
- active site: T10 (≠ S16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M189), T189 (= T190), D212 (= D213), D214 (= D215), V225 (= V226)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-({[3-(1-butyl-1H-1,2,3-triazol-4-yl)propyl]sulfanyl}methyl)pyrrolidin-3-ol: T84 (≠ V90), A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (= F170), I186 (= I187), N187 (≠ G188), M188 (= M189), D212 (= D213), D214 (= D215), V228 (= V229), L232 (≠ V233)
6dyzA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((prop-2-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
44% identity, 82% coverage: 10:251/294 of query aligns to 4:250/273 of 6dyzA
- active site: T10 (≠ S16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M189), T189 (= T190), D212 (= D213), D214 (= D215), V225 (= V226)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(prop-2-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (≠ S16), H57 (= H63), A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (= F170), I186 (= I187), N187 (≠ G188), M188 (= M189), D212 (= D213), D214 (= D215), V228 (= V229)
- binding phosphate ion: G9 (= G15), T10 (≠ S16), R52 (= R58), H53 (= H59), T85 (≠ S91), A86 (= A92), T189 (= T190)
5tc8A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with methylthio-dadme-immucillin-a
44% identity, 82% coverage: 10:251/294 of query aligns to 4:250/273 of 5tc8A
- active site: T10 (≠ S16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M189), T189 (= T190), D212 (= D213), D214 (= D215), V225 (= V226)
- binding (3r,4s)-1-[(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol: T10 (≠ S16), A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (= F170), I186 (= I187), N187 (≠ G188), M188 (= M189), T211 (= T212), D212 (= D213), D214 (= D215), V228 (= V229)
5tc6A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with propylthio-immucillin-a
44% identity, 82% coverage: 10:251/294 of query aligns to 4:250/273 of 5tc6A
- active site: T10 (≠ S16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M189), T189 (= T190), D212 (= D213), D214 (= D215), V225 (= V226)
- binding (2S,3S,4R,5S)-2-(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(propylsulfanyl)methyl]pyrrolidine-3,4-diol: T10 (≠ S16), A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (= F170), N187 (≠ G188), M188 (= M189), D212 (= D213), V225 (= V226), V228 (= V229), L229 (≠ I230)
3ozcA Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase in complex with pcl-phenylthiodadmeimma
44% identity, 82% coverage: 10:251/294 of query aligns to 4:250/273 of 3ozcA
- active site: T10 (≠ S16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M189), T189 (= T190), D212 (= D213), D214 (= D215), V225 (= V226)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(4-chlorophenyl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (≠ S16), H57 (= H63), A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (= F170), I186 (= I187), N187 (≠ G188), M188 (= M189), D212 (= D213), D214 (= D215), V228 (= V229), L229 (≠ I230)
5tc5A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with butylthio-dadme-immucillin-a and chloride
44% identity, 82% coverage: 10:251/294 of query aligns to 17:263/286 of 5tc5A
- active site: T23 (≠ S16), P46 (= P39), H70 (= H63), I72 (= I65), M73 (≠ P66), A99 (= A92), M201 (= M189), T202 (= T190), D225 (= D213), D227 (= D215), V238 (= V226)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(butylsulfanyl)methyl]pyrrolidin-3-ol: A99 (= A92), C100 (≠ V93), G101 (= G94), F182 (= F170), I199 (= I187), M201 (= M189), D225 (= D213), D227 (= D215), V241 (= V229)
5eubA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-mta and sulfate
44% identity, 82% coverage: 10:251/294 of query aligns to 3:249/272 of 5eubA
- active site: T9 (≠ S16), P32 (= P39), H56 (= H63), I58 (= I65), M59 (≠ P66), A85 (= A92), M187 (= M189), T188 (= T190), D211 (= D213), D213 (= D215), V224 (= V226)
- binding (2~{R},3~{R},4~{S},5~{S})-2-[2,6-bis(azanyl)purin-9-yl]-5-(methylsulfanylmethyl)oxolane-3,4-diol: A85 (= A92), C86 (≠ V93), G87 (= G94), F168 (= F170), I185 (= I187), N186 (≠ G188), T210 (= T212), D211 (= D213), D213 (= D215), V227 (= V229)
1sd2A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-methylthiotubercidin (see paper)
45% identity, 82% coverage: 10:251/294 of query aligns to 4:239/262 of 1sd2A
- active site: T10 (≠ S16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M182 (= M189), T183 (= T190), D206 (= D213), D208 (= D215), V214 (= V226)
- binding 2-(4-amino-pyrrolo[2,3-d]pyrimidin-7-yl)-5-methylsulfanylmethyl-tetrahydro-furan-3,4-diol: C87 (≠ V93), G88 (= G94), F163 (= F170), I180 (= I187), N181 (≠ G188), M182 (= M189), D206 (= D213), V217 (= V229)
Q8U4Q8 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; PfMTAP; EC 2.4.2.28 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
45% identity, 88% coverage: 8:266/294 of query aligns to 2:256/257 of Q8U4Q8
- C130 (= C138) modified: Disulfide link with 195
- C195 (= C204) modified: Disulfide link with 130
- C246 (≠ G256) modified: Disulfide link with 248
- C248 (= C258) modified: Disulfide link with 246
1k27A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with a transition state analogue (see paper)
44% identity, 82% coverage: 10:251/294 of query aligns to 4:247/270 of 1k27A
- active site: T10 (≠ S16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M189), T189 (= T190), D212 (= D213), D214 (= D215), V222 (= V226)
- binding (3s,4r)-2-(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(methylsulfanyl)methyl]pyrrolidine-3,4-diol: A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (= F170), N187 (≠ G188), M188 (= M189), D212 (= D213), V225 (= V229)
- binding phosphate ion: G9 (= G15), T10 (≠ S16), R52 (= R58), H53 (= H59), T85 (≠ S91), A86 (= A92), T189 (= T190)
1sd1A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with formycin a (see paper)
44% identity, 82% coverage: 10:251/294 of query aligns to 4:245/268 of 1sd1A
- active site: T10 (≠ S16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M189), T189 (= T190), D212 (= D213), D214 (= D215), V220 (= V226)
- binding (1S)-1-(7-amino-1H-pyrazolo[4,3-d]pyrimidin-3-yl)-1,4-anhydro-D-ribitol: A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (= F170), I186 (= I187), N187 (≠ G188), M188 (= M189), D212 (= D213), D214 (= D215)
1cg6A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-deoxy-5'-methylthioadenosine and sulfate at 1.7 a resolution (see paper)
44% identity, 82% coverage: 10:251/294 of query aligns to 4:245/268 of 1cg6A
- active site: T10 (≠ S16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M189), T189 (= T190), D212 (= D213), D214 (= D215), V220 (= V226)
- binding 5'-deoxy-5'-methylthioadenosine: A86 (= A92), C87 (≠ V93), G88 (= G94), F169 (= F170), N187 (≠ G188), M188 (= M189), D212 (= D213), V223 (= V229)
- binding sulfate ion: G9 (= G15), T10 (≠ S16), R52 (= R58), H53 (= H59), T85 (≠ S91), T189 (= T190)
1cb0A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase at 1.7 a resolution (see paper)
44% identity, 82% coverage: 10:251/294 of query aligns to 4:245/268 of 1cb0A
- active site: T10 (≠ S16), P33 (= P39), H57 (= H63), I59 (= I65), M60 (≠ P66), A86 (= A92), M188 (= M189), T189 (= T190), D212 (= D213), D214 (= D215), V220 (= V226)
- binding adenine: C87 (≠ V93), G88 (= G94), F169 (= F170), D212 (= D213), D214 (= D215)
6dz2A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-(((3-(1-benzyl-1h-1,2,3-triazol-4-yl) propyl)thio)methyl)pyrrolidin-3-ol (see paper)
43% identity, 82% coverage: 10:251/294 of query aligns to 4:247/270 of 6dz2A
- active site: T10 (≠ S16), P33 (= P39), I56 (= I65), M57 (≠ P66), A83 (= A92), M185 (= M189), T186 (= T190), D209 (= D213), D211 (= D215), V222 (= V226)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-({[3-(1-benzyl-1H-1,2,3-triazol-4-yl)propyl]sulfanyl}methyl)pyrrolidin-3-ol: G8 (= G14), T10 (≠ S16), T81 (≠ V90), T82 (≠ S91), A83 (= A92), C84 (≠ V93), G85 (= G94), F166 (= F170), I183 (= I187), N184 (≠ G188), M185 (= M189), D209 (= D213), L229 (≠ V233)
5f7jB Crystal structure of mutant n87t of adenosine/methylthioadenosine phosphorylase from schistosoma mansoni in complex with adenine (see paper)
42% identity, 75% coverage: 10:230/294 of query aligns to 6:247/291 of 5f7jB
- active site: K34 (≠ D38), H59 (= H63), D230 (= D213), D232 (= D215)
- binding adenine: A88 (= A92), C89 (≠ V93), G90 (= G94), F187 (= F170), V204 (≠ I187), N205 (≠ G188), M206 (= M189), D230 (= D213), D232 (= D215), V246 (= V229)
Query Sequence
>AZOBR_RS09940 FitnessBrowser__azobra:AZOBR_RS09940
MAETGSAPVLGVIGGSGVYDIDGLENQRWVKVETPFGDPSDELLTGELNGQKLVFLPRHG
RGHRIPPSELNFRANIYALKALGVTEILSVSAVGSLKEHLPPGTFVVIDQFIDRTFARNK
SFFGTGLVAHVALGHPVCGRLGDLIEEALVELKVPHQRRGTYMVMEGPQFSTKAESELYR
SWGCDVIGMTNMPEAKLAREAEMCYATVAMVTDFDCWHPEHDHVTVDAVIRVVVANAGKA
RSLVKTLAPKLQVRDGLCAQGCHTALDHAIMTAPDKRDPEMLKALDIILARALG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory