SitesBLAST
Comparing AZOBR_RS10015 FitnessBrowser__azobra:AZOBR_RS10015 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n0wA X-ray crystal structure of a serine hydroxymethyltransferase from burkholderia cenocepacia with covalently attached pyridoxal phosphate
63% identity, 98% coverage: 7:422/425 of query aligns to 8:415/416 of 4n0wA
- active site: Y57 (= Y56), E59 (= E58), D202 (= D202), T228 (= T228), K231 (= K231), R237 (= R237)
- binding pyridoxal-5'-phosphate: S99 (= S98), G100 (= G99), S101 (= S100), H128 (= H127), D202 (= D202), A204 (= A204), H205 (= H205), K231 (= K231)
4otlA X-ray crystal structure of serine hydroxymethyl transferase from burkholderia cenocepacia bound to plp and glycine
63% identity, 98% coverage: 7:422/425 of query aligns to 1:408/409 of 4otlA
- active site: Y50 (= Y56), E52 (= E58), D195 (= D202), T221 (= T228), K224 (= K231), R230 (= R237)
- binding glycine: S30 (= S36), Y50 (= Y56), Y60 (= Y66), H121 (= H127), K224 (= K231), R355 (= R363)
- binding pyridoxal-5'-phosphate: S92 (= S98), G93 (= G99), S94 (= S100), H121 (= H127), S170 (= S177), D195 (= D202), A197 (= A204), H198 (= H205), K224 (= K231)
4ot8A X-ray crystal structure of serine hydroxymethyl transferase from burkholderia cenocepacia bound to plp and serine
63% identity, 98% coverage: 7:422/425 of query aligns to 6:413/414 of 4ot8A
- active site: Y55 (= Y56), E57 (= E58), D200 (= D202), T226 (= T228), K229 (= K231), R235 (= R237)
- binding pyridoxal-5'-phosphate: S97 (= S98), G98 (= G99), S99 (= S100), H126 (= H127), D200 (= D202), A202 (= A204), H203 (= H205), K229 (= K231)
- binding serine: S35 (= S36), E57 (= E58), Y65 (= Y66), H126 (= H127), H203 (= H205), R360 (= R363)
6ymfA Crystal structure of serine hydroxymethyltransferase from aphanothece halophytica in the plp-serine external aldimine state (see paper)
58% identity, 98% coverage: 9:425/425 of query aligns to 7:417/418 of 6ymfA
- active site: Y54 (= Y56), E56 (= E58), D200 (= D202), T226 (= T228), K229 (= K231), R235 (= R237)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: S34 (= S36), S96 (= S98), G97 (= G99), A98 (≠ S100), H125 (= H127), S175 (= S177), D200 (= D202), A202 (= A204), H203 (= H205), T226 (= T228), K229 (= K231), R361 (= R363)
6ymdA Crystal structure of serine hydroxymethyltransferase from aphanothece halophytica in the covalent complex with malonate (see paper)
58% identity, 98% coverage: 9:425/425 of query aligns to 7:417/420 of 6ymdA
- active site: Y54 (= Y56), E56 (= E58), D200 (= D202), T226 (= T228), K229 (= K231), R235 (= R237)
- binding malonate ion: S34 (= S36), Y54 (= Y56), E56 (= E58), Y64 (= Y66), H125 (= H127), H203 (= H205), K229 (= K231), R361 (= R363)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: Y54 (= Y56), S96 (= S98), G97 (= G99), A98 (≠ S100), H125 (= H127), Y174 (≠ G176), S175 (= S177), D200 (= D202), A202 (= A204), T226 (= T228), K229 (= K231), G261 (= G263)
1kl2A Crystal structure of serine hydroxymethyltransferase complexed with glycine and 5-formyl tetrahydrofolate (see paper)
60% identity, 96% coverage: 9:416/425 of query aligns to 4:404/405 of 1kl2A
- active site: Y51 (= Y56), E53 (= E58), D197 (= D202), T223 (= T228), K226 (= K231), R232 (= R237)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: E53 (= E58), Y60 (= Y65), G121 (= G126), H122 (= H127), S172 (= S177), F251 (= F257), N341 (= N347)
- binding glycine: S31 (= S36), Y51 (= Y56), Y61 (= Y66), H200 (= H205), R357 (= R363)
- binding pyridoxal-5'-phosphate: S93 (= S98), G94 (= G99), A95 (≠ S100), H122 (= H127), S172 (= S177), D197 (= D202), A199 (= A204), H200 (= H205), T223 (= T228), H225 (= H230), K226 (= K231)
1kl1A Crystal structure of serine hydroxymethyltransferase complexed with glycine (see paper)
60% identity, 96% coverage: 9:416/425 of query aligns to 4:404/405 of 1kl1A
- active site: Y51 (= Y56), E53 (= E58), D197 (= D202), T223 (= T228), K226 (= K231), R232 (= R237)
- binding glycine: S31 (= S36), H122 (= H127), R357 (= R363)
- binding pyridoxal-5'-phosphate: S93 (= S98), G94 (= G99), A95 (≠ S100), H122 (= H127), A171 (≠ G176), S172 (= S177), D197 (= D202), A199 (= A204), H200 (= H205), T223 (= T228), H225 (= H230), K226 (= K231)
1kkpA Crystal structure of serine hydroxymethyltransferase complexed with serine (see paper)
60% identity, 96% coverage: 9:416/425 of query aligns to 4:404/405 of 1kkpA
- active site: Y51 (= Y56), E53 (= E58), D197 (= D202), T223 (= T228), K226 (= K231), R232 (= R237)
- binding pyridoxal-5'-phosphate: S93 (= S98), G94 (= G99), A95 (≠ S100), H122 (= H127), S172 (= S177), D197 (= D202), A199 (= A204), H200 (= H205), K226 (= K231)
- binding serine: S31 (= S36), H122 (= H127), R357 (= R363)
1kkjA Crystal structure of serine hydroxymethyltransferase from b.Stearothermophilus (see paper)
60% identity, 96% coverage: 9:416/425 of query aligns to 4:404/405 of 1kkjA
- active site: Y51 (= Y56), E53 (= E58), D197 (= D202), T223 (= T228), K226 (= K231), R232 (= R237)
- binding pyridoxal-5'-phosphate: S93 (= S98), G94 (= G99), A95 (≠ S100), H122 (= H127), S172 (= S177), D197 (= D202), A199 (= A204), H200 (= H205), T223 (= T228), H225 (= H230), K226 (= K231)
2vmyA Crystal structure of f351gbsshmt in complex with gly and fthf (see paper)
60% identity, 96% coverage: 9:416/425 of query aligns to 4:404/405 of 2vmyA
- active site: Y51 (= Y56), E53 (= E58), D197 (= D202), T223 (= T228), K226 (= K231), R232 (= R237)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: E53 (= E58), Y60 (= Y65), Y61 (= Y66), L117 (= L122), G121 (= G126), H122 (= H127), L123 (= L128), S172 (= S177), K248 (≠ S254), F251 (= F257), N341 (= N347), S349 (≠ K355), P350 (= P356), G351 (≠ M357), R357 (= R363)
- binding glycine: S31 (= S36), Y51 (= Y56), Y61 (= Y66), H200 (= H205), K226 (= K231), R357 (= R363)
- binding pyridoxal-5'-phosphate: Y51 (= Y56), S93 (= S98), G94 (= G99), A95 (≠ S100), H122 (= H127), S172 (= S177), D197 (= D202), A199 (= A204), H200 (= H205), T223 (= T228), K226 (= K231), G257 (= G263)
2vmxA Crystal structure of f351gbsshmt in complex with l-allo-thr (see paper)
60% identity, 96% coverage: 9:416/425 of query aligns to 4:404/405 of 2vmxA
- active site: Y51 (= Y56), E53 (= E58), D197 (= D202), T223 (= T228), K226 (= K231), R232 (= R237)
- binding allo-threonine: S31 (= S36), H122 (= H127), H200 (= H205), R357 (= R363)
- binding pyridoxal-5'-phosphate: S93 (= S98), G94 (= G99), A95 (≠ S100), H122 (= H127), S172 (= S177), D197 (= D202), A199 (= A204), H200 (= H205), T223 (= T228), K226 (= K231)
Q5SI56 Serine hydroxymethyltransferase; SHMT; Serine methylase; EC 2.1.2.1 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
59% identity, 97% coverage: 8:421/425 of query aligns to 3:406/407 of Q5SI56
- Y51 (= Y56) binding
- GS 94:95 (= GS 99:100) binding
- S172 (= S177) binding
- H200 (= H205) binding
- H225 (= H230) binding
- K226 (= K231) modified: N6-(pyridoxal phosphate)lysine
- G258 (= G263) binding
8suiB Joint x-ray/neutron structure of thermus thermophilus serine hydroxymethyltransferase (tthshmt) in internal aldimine state with l- ser bound in a pre-michalis complex (see paper)
61% identity, 93% coverage: 26:421/425 of query aligns to 16:401/402 of 8suiB
8ssyA Room-temperature x-ray structure of thermus thermophilus serine hydroxymethyltransferase (shmt) bound with d-ser in a pseudo- michaelis complex (see paper)
61% identity, 93% coverage: 26:421/425 of query aligns to 16:401/402 of 8ssyA
2dkjA Crystal structure of t.Th.Hb8 serine hydroxymethyltransferase
61% identity, 93% coverage: 26:421/425 of query aligns to 16:401/402 of 2dkjA
- active site: Y46 (= Y56), E48 (= E58), D192 (= D202), T218 (= T228), K221 (= K231), R227 (= R237)
- binding pyridoxal-5'-phosphate: S88 (= S98), G89 (= G99), S90 (= S100), H117 (= H127), S167 (= S177), D192 (= D202), A194 (= A204), H220 (= H230), K221 (= K231)
7x5oB Crystal structure of e. Faecium shmt in complex with me-thf and plp- gly (see paper)
58% identity, 96% coverage: 13:422/425 of query aligns to 7:411/412 of 7x5oB
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: S30 (= S36), Y50 (= Y56), Y60 (= Y66), S92 (= S98), G93 (= G99), S94 (= S100), H121 (= H127), S171 (= S177), D196 (= D202), A198 (= A204), H199 (= H205), K225 (= K231), R358 (= R363)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: E52 (= E58), Y59 (= Y65), L116 (= L122), G119 (= G125), G120 (= G126), H121 (= H127), S171 (= S177), P252 (= P258), N342 (= N347), P351 (= P356)
7x5nA Crystal structure of e. Faecium shmt in complex with (+)-shin-1 and plp-ser (see paper)
58% identity, 96% coverage: 13:421/425 of query aligns to 6:409/409 of 7x5nA
- binding (4R)-6-azanyl-4-[3-(hydroxymethyl)-5-phenyl-phenyl]-3-methyl-4-propan-2-yl-1H-pyrano[2,3-c]pyrazole-5-carbonitrile: E51 (= E58), Y58 (= Y65), Y59 (= Y66), L115 (= L122), G119 (= G126), H120 (= H127), L121 (= L128), K340 (= K346), N341 (= N347), S342 (≠ G348), P350 (= P356), F351 (≠ M357), R357 (= R363)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: S29 (= S36), Y49 (= Y56), E51 (= E58), Y59 (= Y66), S91 (= S98), G92 (= G99), S93 (= S100), H120 (= H127), S170 (= S177), D195 (= D202), A197 (= A204), H198 (= H205), K224 (= K231), R357 (= R363)
7v3dA Complex structure of serine hydroxymethyltransferase from enterococcus faecium and its inhibitor (see paper)
58% identity, 96% coverage: 13:421/425 of query aligns to 6:409/409 of 7v3dA
- binding (4R)-6-azanyl-4-[3-(hydroxymethyl)-5-phenyl-phenyl]-3-methyl-4-propan-2-yl-1H-pyrano[2,3-c]pyrazole-5-carbonitrile: E51 (= E58), Y58 (= Y65), L115 (= L122), G119 (= G126), H120 (= H127), L121 (= L128), K340 (= K346), S342 (≠ G348), P350 (= P356), F351 (≠ M357), R357 (= R363)
- binding pyridoxal-5'-phosphate: Y49 (= Y56), S91 (= S98), G92 (= G99), S93 (= S100), H120 (= H127), S170 (= S177), D195 (= D202), A197 (= A204), K224 (= K231), G255 (= G262)
3pgyB Serine hydroxymethyltransferase from staphylococcus aureus, s95p mutant.
57% identity, 97% coverage: 9:422/425 of query aligns to 4:404/404 of 3pgyB
1dfoB Crystal structure at 2.4 angstrom resolution of e. Coli serine hydroxymethyltransferase in complex with glycine and 5-formyl tetrahydrofolate (see paper)
59% identity, 98% coverage: 8:422/425 of query aligns to 7:416/417 of 1dfoB
- active site: Y55 (= Y56), E57 (= E58), D200 (= D202), T226 (= T228), K229 (= K231), R235 (= R237)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: E57 (= E58), Y64 (= Y65), Y65 (= Y66), L121 (= L122), G125 (= G126), H126 (= H127), L127 (= L128), S175 (= S177), S245 (= S245), E247 (= E247), N347 (= N347), S355 (≠ K355), P356 (= P356), F357 (≠ M357)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: S35 (= S36), Y55 (= Y56), Y65 (= Y66), S97 (= S98), G98 (= G99), S99 (= S100), H126 (= H127), F174 (≠ G176), S175 (= S177), D200 (= D202), A202 (= A204), H203 (= H205), K229 (= K231), G262 (= G262), R363 (= R363)
Query Sequence
>AZOBR_RS10015 FitnessBrowser__azobra:AZOBR_RS10015
IGRFFAASLAETDPELARAVRDELVRQQEQIELIASENIVSQAVLEAQGSVMTNKYAEGY
PGRRYYGGCEYVDVAETLAIERACKLFGCGFANVQPNSGSQANQAVNLALLQPGDTILGM
SLAAGGHLTHGAAPNLSGKWFKAVQYGVRRDDHLIDFDEVERLAREHKPKLIIAGGSAYP
RVLDYQRFRAIADEVGAYFMVDIAHYAGLIAGGVYPNPFPYADVVTTTTHKTLRGPRGGM
VLTNSEEIAKKINSAVFPGLQGGPLMHVIAAKAVAFAEALRPEFKTYAKSVLDNARALSK
VLIEGGLDIVSGGTDSHIVLVDLRPKNLTGKAAEASLEHAGMTCNKNGVPFDPQKPMVTS
GVRLGSPAATTRGFGVAEFEQVGRLIVETLDGLAASNSGDNAAVEAKVREEVRELCRRFP
IYPTL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory