Comparing AZOBR_RS10265 FitnessBrowser__azobra:AZOBR_RS10265 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
34% identity, 80% coverage: 40:261/279 of query aligns to 1:218/229 of 5t0wA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
25% identity, 80% coverage: 49:270/279 of query aligns to 4:225/234 of 3k4uE
5kkwA Crystal structure of sar11_1068 bound to a sulfobetaine (3-(1- methylpiperidinium-1-yl)propane-1-sulfonate)
25% identity, 85% coverage: 39:276/279 of query aligns to 1:237/237 of 5kkwA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
28% identity, 76% coverage: 49:261/279 of query aligns to 4:215/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
28% identity, 76% coverage: 49:261/279 of query aligns to 4:213/225 of 4zv2A
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
30% identity, 61% coverage: 39:209/279 of query aligns to 1:172/240 of 4h5fA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
26% identity, 79% coverage: 42:262/279 of query aligns to 3:218/229 of 6svfA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
25% identity, 79% coverage: 42:261/279 of query aligns to 6:220/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
25% identity, 79% coverage: 42:261/279 of query aligns to 10:224/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
25% identity, 79% coverage: 42:261/279 of query aligns to 10:224/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
25% identity, 79% coverage: 42:261/279 of query aligns to 10:224/241 of 3vvdA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
26% identity, 77% coverage: 49:262/279 of query aligns to 1:213/224 of 4ymxA
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
26% identity, 77% coverage: 49:264/279 of query aligns to 7:229/239 of 4zefA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
25% identity, 83% coverage: 45:275/279 of query aligns to 7:234/247 of 2yjpA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
23% identity, 80% coverage: 42:264/279 of query aligns to 1:224/237 of 4i62A
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
23% identity, 70% coverage: 71:264/279 of query aligns to 27:219/230 of 4kqpA
Sites not aligning to the query:
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
27% identity, 67% coverage: 74:261/279 of query aligns to 26:211/226 of 8eyzA
Sites not aligning to the query:
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
25% identity, 72% coverage: 62:261/279 of query aligns to 27:224/235 of 4g4pA
Sites not aligning to the query:
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
25% identity, 51% coverage: 69:209/279 of query aligns to 19:158/225 of 3tqlA
Sites not aligning to the query:
7a99B Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp (see paper)
28% identity, 33% coverage: 42:134/279 of query aligns to 2:93/130 of 7a99B
Sites not aligning to the query:
>AZOBR_RS10265 FitnessBrowser__azobra:AZOBR_RS10265
MVRESEVVRRLSIALTALALHAALQSVFLVSGAAPVRAESRLDRVQRNGLLRVCIWPDYY
AISFRSSYSGELQGLDIDMARAFAHDLGARVSFVESGFPNFVADLLSDRCDIGMFGIGVT
AARAEKIAFSQPYLRSGIYAVSSQTHPRILRWDDLDQDGMVVAVQKGTVMDDYASLAFRK
ASVRIVSGPLEREEEVQSGRADAFLTDYPYGQRMLAFHQWAHLIAPENPVQTTPYAYAVA
PGDPLWLDRVNRFVDAVKRDGRLEAAAARFRLTPIVARD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory