Comparing AZOBR_RS11675 FitnessBrowser__azobra:AZOBR_RS11675 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O32445 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
45% identity, 99% coverage: 1:379/383 of query aligns to 1:374/378 of O32445
3iv8A N-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate
45% identity, 99% coverage: 1:379/383 of query aligns to 2:375/379 of 3iv8A
2p50A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
42% identity, 100% coverage: 1:382/383 of query aligns to 1:380/382 of 2p50A
P0AF18 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Escherichia coli (strain K12) (see 2 papers)
42% identity, 100% coverage: 1:382/383 of query aligns to 1:380/382 of P0AF18
2p53A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate (see paper)
42% identity, 100% coverage: 1:382/383 of query aligns to 1:380/382 of 2p53A
1yrrA Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
42% identity, 100% coverage: 1:382/383 of query aligns to 1:379/381 of 1yrrA
6jkuA Crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida (see paper)
39% identity, 99% coverage: 1:379/383 of query aligns to 8:381/385 of 6jkuA
2p50B Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
40% identity, 100% coverage: 1:382/383 of query aligns to 1:354/356 of 2p50B
1yrrB Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
38% identity, 99% coverage: 3:382/383 of query aligns to 2:332/334 of 1yrrB
7nutA Crystal structure of human amdhd2 in complex with zn and glcn6p (see paper)
40% identity, 88% coverage: 45:380/383 of query aligns to 52:395/401 of 7nutA
1o12A Crystal structure of n-acetylglucosamine-6-phosphate deacetylase (tm0814) from thermotoga maritima at 2.5 a resolution
33% identity, 94% coverage: 23:381/383 of query aligns to 22:360/363 of 1o12A
2vhlB The three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis (see paper)
32% identity, 97% coverage: 11:381/383 of query aligns to 13:386/393 of 2vhlB
O34450 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Bacillus subtilis (strain 168) (see paper)
32% identity, 97% coverage: 11:381/383 of query aligns to 14:387/396 of O34450
6fv4A The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
37% identity, 98% coverage: 9:382/383 of query aligns to 5:380/381 of 6fv4A
6fv4B The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
37% identity, 98% coverage: 9:382/383 of query aligns to 5:380/385 of 6fv4B
6fv3D Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase from mycobacterium smegmatis. (see paper)
35% identity, 98% coverage: 9:382/383 of query aligns to 3:350/350 of 6fv3D
1ybqA Crystal structure of escherichia coli isoaspartyl dipeptidase mutant d285n complexed with beta-aspartylhistidine (see paper)
36% identity, 30% coverage: 21:136/383 of query aligns to 29:142/389 of 1ybqA
Sites not aligning to the query:
1pokA Crystal structure of isoaspartyl dipeptidase (see paper)
36% identity, 30% coverage: 21:136/383 of query aligns to 29:142/377 of 1pokA
Sites not aligning to the query:
1onxA Crystal structure of isoaspartyl dipeptidase from escherichia coli complexed with aspartate (see paper)
36% identity, 30% coverage: 21:136/383 of query aligns to 29:142/389 of 1onxA
Sites not aligning to the query:
1pojA Isoaspartyl dipeptidase with bound inhibitor (see paper)
36% identity, 30% coverage: 21:136/383 of query aligns to 29:142/388 of 1pojA
Sites not aligning to the query:
>AZOBR_RS11675 FitnessBrowser__azobra:AZOBR_RS11675
LTALVNATLHTGDSVLAGAALLIDGPAIAAIVAPEAIPPEAAVIDLGGGILAPGFIDLQV
NGGGGALFNDTPDLPTLRRIAEAHRRFGTTGLLPTLITDSAEKRAVAVAAVRAALAQGMP
GVLGIHLEGPHIAPERRGVHDARFIAPPDADDLALLGGLSGLPALVTLAPEAVPPEPIRR
LAAAGLRIAAGHSTATWAQAKAGFAAGITGVTHLFNAMSPLGSREPGMVGAALEDDAVWC
GIIVDGHHVHDASVRLAWKAKTPGRLFLVTDAMPPVGAPEDHPAGNFQLYGEEIRVEDGR
CVTADGTLAGSALDMATAVRNAVERVGIPLDEALRMASAYPADFMGMAGRRGRIRPGLAA
DLVHLDERLRVRATWISGKMAVP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory