Comparing AZOBR_RS12155 FitnessBrowser__azobra:AZOBR_RS12155 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WQB3 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
54% identity, 97% coverage: 20:568/568 of query aligns to 45:644/644 of P9WQB3
3figB Crystal structure of leucine-bound leua from mycobacterium tuberculosis (see paper)
56% identity, 98% coverage: 14:568/568 of query aligns to 22:577/577 of 3figB
3hpzB Crystal structure of mycobacterium tuberculosis leua complexed with bromopyruvate
55% identity, 98% coverage: 14:567/568 of query aligns to 22:576/576 of 3hpzB
3hq1A Crystal structure of mycobacterium tuberculosis leua complexed with citrate and mn2+
55% identity, 98% coverage: 14:567/568 of query aligns to 22:573/573 of 3hq1A
1sr9A Crystal structure of leua from mycobacterium tuberculosis (see paper)
55% identity, 98% coverage: 14:567/568 of query aligns to 22:573/573 of 1sr9A
3hpsA Crystal structure of mycobacterium tuberculosis leua complexed with ketoisocaproate (kic)
55% identity, 98% coverage: 14:567/568 of query aligns to 22:575/575 of 3hpsA
4ov4A Isopropylmalate synthase binding with ketoisovalerate (see paper)
29% identity, 69% coverage: 48:440/568 of query aligns to 9:374/379 of 4ov4A
4ov9A Structure of isopropylmalate synthase binding with alpha- isopropylmalate (see paper)
29% identity, 69% coverage: 48:440/568 of query aligns to 9:376/380 of 4ov9A
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
26% identity, 91% coverage: 50:565/568 of query aligns to 14:501/517 of Q9JZG1
Sites not aligning to the query:
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
27% identity, 73% coverage: 19:435/568 of query aligns to 2:406/409 of 6e1jA
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 64% coverage: 50:412/568 of query aligns to 92:443/503 of Q9FN52
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 77% coverage: 4:438/568 of query aligns to 53:476/506 of Q9FG67
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
29% identity, 52% coverage: 50:344/568 of query aligns to 11:293/308 of 3rmjB
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
23% identity, 59% coverage: 50:384/568 of query aligns to 42:343/418 of Q9Y823
Sites not aligning to the query:
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
23% identity, 59% coverage: 50:384/568 of query aligns to 37:338/400 of 3ivtB
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
23% identity, 59% coverage: 50:384/568 of query aligns to 19:309/370 of 3mi3A
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
23% identity, 62% coverage: 50:400/568 of query aligns to 29:346/399 of 6ktqA
3ivsA Homocitrate synthase lys4 (see paper)
22% identity, 59% coverage: 50:384/568 of query aligns to 19:307/364 of 3ivsA
Q53WI0 4-hydroxy-2-oxovalerate aldolase; HOA; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxohexanoate aldolase; 4-hydroxy-2-oxopentanoate aldolase; EC 4.1.3.39; EC 4.1.3.43 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
24% identity, 52% coverage: 41:337/568 of query aligns to 9:278/347 of Q53WI0
Sites not aligning to the query:
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
26% identity, 55% coverage: 45:354/568 of query aligns to 4:296/376 of O87198
>AZOBR_RS12155 FitnessBrowser__azobra:AZOBR_RS12155
MNHIATPAATSATSAAKHEKYVPFAPVKLTDRQWPNRTIEKAPVWCSVDLRDGNQALIEP
MGPDRKRAMFDALLKMGFKEIEIGFPAASQTDFDFCREIIEGGKIPDGVTIQVLTQAREE
LIRRTFEGIKGAKRAIVHLYNSTSELQRRVVFGLDRQGIVDIAVAGTKLIKQLAAEHPET
EIVLQYSPESFTGTELEFALEICEAVMETWGADAANKVILNLPATVEMSTPNIHADQIEW
FCRNMKNRDAAIISLHPHNDRGTGVAAAELGMLAGADRVEGTLFGNGERTGNVDVITLAL
NLLTQGVDPELRIDDINEIVRVAEYCTQLPVHPRHPYAGELVFTAFSGSHQDAINKGLKA
LAKSNHGTWEVPYLPIDPQDLGRSYEAVIRINSQSGKGGIAYVLEKDYGIQIPRRLQIEF
SKTVQRIADETGKELAPADIHNAFKAEYLDIDAPLALIEHSTEPRGPNSGARVLNVVVSR
DGVVSTLKGSGKGPIDAFLDALRQGAGIDLHVVDYREHAVGEGEDAQACAYVEVKTNDER
TLFGVGMDADIVTASLRALVSAANRASR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory