SitesBLAST
Comparing AZOBR_RS12495 FitnessBrowser__azobra:AZOBR_RS12495 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P38502 Acetate kinase; Acetokinase; EC 2.7.2.1 from Methanosarcina thermophila (see 5 papers)
39% identity, 97% coverage: 12:401/402 of query aligns to 3:398/408 of P38502
- N7 (= N16) mutation to A: Almost abolishes catalytic activity. Requires increased magnesium levels for activity. Strongly decreases affinity for acetate.; mutation to D: Almost abolishes catalytic activity. Strongly decreases affinity for acetate.
- S10 (= S19) mutation S->A,T: Strongly decreases catalytic activity. Strongly decreases affinity for acetate.
- S12 (= S21) mutation to A: Decreases catalytic activity. Strongly decreases affinity for acetate. Requires increased magnesium levels for enzyme activity.; mutation to T: Decreases catalytic activity. Strongly decreases affinity for acetate.
- K14 (= K23) mutation to A: Strongly decreases enzyme activity.; mutation to R: Reduces enzyme activity.
- R91 (= R101) mutation R->A,L: Decreases catalytic activity. Decreases affinity for acetate.
- V93 (= V103) mutation to A: Decreases affinity for acetate.
- L122 (= L132) mutation to A: Decreases affinity for acetate.
- D148 (= D158) active site, Proton donor/acceptor; mutation D->A,E,N: Abolishes catalytic activity. Decreases affinity for acetate, but not for ATP.
- F179 (= F188) mutation to A: Decreases affinity for acetate.
- N211 (≠ S219) mutation to A: Slightly reduced enzyme activity.
- P232 (≠ A240) mutation to A: Decreases affinity for acetate.
- R241 (= R249) mutation R->K,L: Decreases catalytic activity. Strongly reduced affinity for ATP.
- E384 (= E387) mutation to A: Almost abolishes catalytic activity. Strongly decreases affinity for acetate. Requires strongly increased magnesium levels for enzyme activity.
1tuuA Acetate kinase crystallized with atpgs (see paper)
39% identity, 97% coverage: 12:401/402 of query aligns to 3:398/399 of 1tuuA
- active site: N7 (= N16), R91 (= R101), H180 (= H189), R241 (= R249), E384 (= E387)
- binding adenosine-5'-diphosphate: K14 (= K23), G210 (= G218), D283 (= D291), F284 (≠ M292), R285 (= R293), G331 (= G336), I332 (= I337), N335 (≠ R340)
- binding sulfate ion: R91 (= R101), H180 (= H189), G212 (= G220)
1tuuB Acetate kinase crystallized with atpgs (see paper)
39% identity, 97% coverage: 12:401/402 of query aligns to 3:398/398 of 1tuuB
- active site: N7 (= N16), R91 (= R101), H180 (= H189), R241 (= R249), E384 (= E387)
- binding adenosine monophosphate: D283 (= D291), R285 (= R293), G331 (= G336), I332 (= I337), N335 (≠ R340), S336 (= S341)
- binding trihydrogen thiodiphosphate: H180 (= H189), G212 (= G220), R241 (= R249)
7fj9A Kpacka (pduw) with amppnp complex structure
41% identity, 95% coverage: 12:392/402 of query aligns to 4:385/395 of 7fj9A
7fj8A Kpacka (pduw) with amp complex structure
41% identity, 95% coverage: 12:392/402 of query aligns to 4:385/395 of 7fj8A
4fwsA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with ctp (see paper)
40% identity, 95% coverage: 12:393/402 of query aligns to 4:384/394 of 4fwsA
- active site: N8 (= N16), R83 (= R101), H172 (= H189), R233 (= R249), E378 (= E387)
- binding cytidine-5'-triphosphate: G202 (= G218), N203 (≠ S219), G204 (= G220), D275 (= D291), L276 (≠ M292), R277 (= R293), G323 (= G336), I324 (= I337), N327 (≠ R340)
- binding 1,2-ethanediol: V21 (≠ A32), C24 (≠ L35), H115 (= H133), N203 (≠ S219), T232 (= T248), R233 (= R249), K262 (≠ N278)
4fwrA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with cmp (see paper)
40% identity, 95% coverage: 12:393/402 of query aligns to 4:384/394 of 4fwrA
- active site: N8 (= N16), R83 (= R101), H172 (= H189), R233 (= R249), E378 (= E387)
- binding cytidine-5'-monophosphate: G202 (= G218), N203 (≠ S219), D275 (= D291), L276 (≠ M292), R277 (= R293), G323 (= G336), I324 (= I337), N327 (≠ R340)
4fwqA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gtp (see paper)
40% identity, 95% coverage: 12:393/402 of query aligns to 4:384/394 of 4fwqA
- active site: N8 (= N16), R83 (= R101), H172 (= H189), R233 (= R249), E378 (= E387)
- binding guanosine-5'-triphosphate: H172 (= H189), N203 (≠ S219), G204 (= G220), D275 (= D291), L276 (≠ M292), R277 (= R293), E280 (≠ L296), G323 (= G336), I324 (= I337), N327 (≠ R340)
4fwpA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gdp (see paper)
40% identity, 95% coverage: 12:393/402 of query aligns to 4:384/394 of 4fwpA
- active site: N8 (= N16), R83 (= R101), H172 (= H189), R233 (= R249), E378 (= E387)
- binding 1,2-ethanediol: S11 (= S19), H115 (= H133), K262 (≠ N278)
- binding guanosine-5'-diphosphate: N203 (≠ S219), D275 (= D291), L276 (≠ M292), R277 (= R293), E280 (≠ L296), G323 (= G336), I324 (= I337), N327 (≠ R340), S328 (= S341)
4fwoA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gmp (see paper)
40% identity, 95% coverage: 12:393/402 of query aligns to 4:384/394 of 4fwoA
- active site: N8 (= N16), R83 (= R101), H172 (= H189), R233 (= R249), E378 (= E387)
- binding guanosine-5'-monophosphate: G202 (= G218), N203 (≠ S219), D275 (= D291), L276 (≠ M292), R277 (= R293), E280 (≠ L296), G323 (= G336), I324 (= I337), N327 (≠ R340)
- binding 1,2-ethanediol: E100 (≠ A118), N104 (≠ E122)
4fwnA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with adenosine tetraphosphate (ap4) (see paper)
40% identity, 95% coverage: 12:393/402 of query aligns to 4:384/394 of 4fwnA
- active site: N8 (= N16), R83 (= R101), H172 (= H189), R233 (= R249), E378 (= E387)
- binding adenosine-5'-tetraphosphate: H172 (= H189), H200 (= H216), N203 (≠ S219), G204 (= G220), D275 (= D291), L276 (≠ M292), R277 (= R293), G323 (= G336), I324 (= I337), N327 (≠ R340)
4fwmA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with atp (see paper)
40% identity, 95% coverage: 12:393/402 of query aligns to 4:384/394 of 4fwmA
- active site: N8 (= N16), R83 (= R101), H172 (= H189), R233 (= R249), E378 (= E387)
- binding adenosine-5'-triphosphate: H172 (= H189), H200 (= H216), N203 (≠ S219), G204 (= G220), D275 (= D291), L276 (≠ M292), R277 (= R293), G323 (= G336), I324 (= I337), N327 (≠ R340)
- binding 1,2-ethanediol: H172 (= H189), R233 (= R249)
4fwkA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with amp (see paper)
40% identity, 95% coverage: 12:393/402 of query aligns to 4:384/394 of 4fwkA
- active site: N8 (= N16), R83 (= R101), H172 (= H189), R233 (= R249), E378 (= E387)
- binding adenosine monophosphate: G202 (= G218), N203 (≠ S219), D275 (= D291), L276 (≠ M292), R277 (= R293), G323 (= G336), I324 (= I337), N327 (≠ R340)
- binding 1,2-ethanediol: D103 (≠ E121), N104 (≠ E122), R107 (≠ S125)
2e1zA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with diadenosine tetraphosphate (ap4a) obtained after co- crystallization with atp (see paper)
40% identity, 95% coverage: 12:393/402 of query aligns to 4:384/394 of 2e1zA
- active site: N8 (= N16), R83 (= R101), H172 (= H189), R233 (= R249), E378 (= E387)
- binding bis(adenosine)-5'-tetraphosphate: N8 (= N16), R83 (= R101), H115 (= H133), G202 (= G218), N203 (≠ S219), G204 (= G220), P224 (≠ A240), R233 (= R249), D275 (= D291), L276 (≠ M292), R277 (= R293), G323 (= G336), I324 (= I337), N327 (≠ R340)
1x3nA Crystal structure of amppnp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
40% identity, 95% coverage: 12:393/402 of query aligns to 4:384/394 of 1x3nA
- active site: N8 (= N16), R83 (= R101), H172 (= H189), R233 (= R249), E378 (= E387)
- binding phosphoaminophosphonic acid-adenylate ester: G202 (= G218), N203 (≠ S219), G204 (= G220), D275 (= D291), L276 (≠ M292), R277 (= R293), G323 (= G336), I324 (= I337), N327 (≠ R340)
1x3mA Crystal structure of adp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
40% identity, 95% coverage: 12:393/402 of query aligns to 4:384/394 of 1x3mA
- active site: N8 (= N16), R83 (= R101), H172 (= H189), R233 (= R249), E378 (= E387)
- binding adenosine-5'-diphosphate: G202 (= G218), N203 (≠ S219), D275 (= D291), L276 (≠ M292), R277 (= R293), G322 (≠ A335), G323 (= G336), I324 (= I337), N327 (≠ R340)
4ijnA Crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate (see paper)
39% identity, 95% coverage: 12:392/402 of query aligns to 4:370/376 of 4ijnA
- active site: N8 (= N16), R72 (= R101), H161 (= H189), R222 (= R249), E365 (= E387)
- binding adenosine monophosphate: G191 (= G218), N192 (≠ S219), D263 (≠ N290), F264 (vs. gap), R265 (vs. gap), G311 (= G336), V312 (≠ I337), N315 (≠ R340), V316 (≠ S341)
4iz9A Crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese (see paper)
38% identity, 98% coverage: 8:399/402 of query aligns to 2:379/381 of 4iz9A
- active site: N10 (= N16), R74 (= R101), H163 (= H189), R224 (= R249), E367 (= E387)
- binding diphosphomethylphosphonic acid adenosyl ester: K17 (= K23), G193 (= G218), N194 (≠ S219), D265 (≠ N290), F266 (vs. gap), R267 (vs. gap), G313 (= G336), I314 (= I337), N317 (≠ R340), D318 (≠ S341)
1sazA Membership in the askha superfamily: enzymological properties and crystal structure of butyrate kinase 2 from thermotoga maritima (see paper)
25% identity, 47% coverage: 184:373/402 of query aligns to 149:342/375 of 1sazA
- active site: R214 (= R249)
- binding phosphomethylphosphonic acid adenylate ester: H154 (= H189), G184 (= G218), G185 (≠ S219), G186 (= G220), S254 (= S289), D255 (≠ N290), A256 (≠ D291), R257 (≠ M292), G304 (= G336), L305 (≠ I337), H307 (≠ E339)
Query Sequence
>AZOBR_RS12495 FitnessBrowser__azobra:AZOBR_RS12495
MTSQNAGGGNAILVINAGSSSLKFSVFRESGAGGLRVTINGQISGIGTEPKFEAKDAAKN
PLAERVWAAGEPSDRTALLAFLLEWIEGRLDGAKLLAAGHRVVHGGTRHAAPVLLTPAVM
EELESFIPLAPLHQPHNLAAIRALAEAHPELPQVACFDTAFHRGQPWQSQMFAIPRELTD
EGVRRYGFHGLSYEYIARRLPELAPELADGRVVVAHLGSGASMCAIHAGRSVDSTMGFTA
LDGLPMGTRCGNIDPGVLIYLMRQKGMGADAIEKLLYNKSGLLGVSGLSNDMRALLDSED
PHAEEAVELFCFRIAKETGALAASMGGIDALVFTAGIGERSAPVRARVGDKLAWLGVILD
PAANEANGPLISAPNSRIPVYVIPTDEEQMIALHSRKALETA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory