Comparing AZOBR_RS12500 FitnessBrowser__azobra:AZOBR_RS12500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
41% identity, 46% coverage: 249:468/483 of query aligns to 68:283/288 of 3u9eB
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
41% identity, 46% coverage: 249:468/483 of query aligns to 66:281/285 of 3uf6A
P86397 Hydroxyacyl-thioester dehydratase type 2, mitochondrial; HsHTD2; 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; EC 4.2.1.59 from Homo sapiens (Human) (see paper)
32% identity, 28% coverage: 20:156/483 of query aligns to 28:163/168 of P86397
Sites not aligning to the query:
O32472 (R)-specific enoyl-CoA hydratase; EC 4.2.1.119 from Aeromonas caviae (Aeromonas punctata) (see 2 papers)
40% identity, 27% coverage: 26:156/483 of query aligns to 4:134/134 of O32472
Sites not aligning to the query:
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
27% identity, 54% coverage: 195:456/483 of query aligns to 21:309/325 of 1xcoD
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 57% coverage: 203:476/483 of query aligns to 416:714/714 of Q8ZND6
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
27% identity, 61% coverage: 182:476/483 of query aligns to 14:332/332 of 2af3C
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
27% identity, 61% coverage: 182:476/483 of query aligns to 15:333/333 of P38503
Sites not aligning to the query:
A0A3Q7HWE4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FERN, mitochondrial; 3-hydroxyl-ACP dehydratase FERN; Protein FERN-LIKE; SlFERN; EC 4.2.1.59 from Solanum lycopersicum (Tomato) (Lycopersicon esculentum) (see paper)
31% identity, 27% coverage: 28:157/483 of query aligns to 23:152/165 of A0A3Q7HWE4
6jqoA Structure of paaz, a bifunctional enzyme in complex with NADP+ and ccoa (see paper)
39% identity, 22% coverage: 25:130/483 of query aligns to 530:637/678 of 6jqoA
Sites not aligning to the query:
6jqnA Structure of paaz, a bifunctional enzyme in complex with NADP+ and ocoa (see paper)
39% identity, 22% coverage: 25:130/483 of query aligns to 530:637/678 of 6jqnA
Sites not aligning to the query:
6jqmA Structure of paaz with NADPH (see paper)
39% identity, 22% coverage: 25:130/483 of query aligns to 530:637/678 of 6jqmA
Sites not aligning to the query:
P77455 Bifunctional protein PaaZ; EC 3.3.2.12; EC 1.2.1.91 from Escherichia coli (strain K12) (see paper)
39% identity, 22% coverage: 25:130/483 of query aligns to 531:638/681 of P77455
Sites not aligning to the query:
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
28% identity, 42% coverage: 256:457/483 of query aligns to 114:320/339 of 6ioxA
7tuiB Structure of c. Albicans fas in an inhibited state
34% identity, 17% coverage: 7:88/483 of query aligns to 1494:1575/2033 of 7tuiB
Sites not aligning to the query:
6u5wB Electron cryomicroscopy structure of c. Albicans fas in the ks-stalled state (see paper)
34% identity, 17% coverage: 7:88/483 of query aligns to 1494:1575/2033 of 6u5wB
Sites not aligning to the query:
6zngF Maeb full-length acetyl-coa bound state (see paper)
23% identity, 51% coverage: 195:442/483 of query aligns to 440:713/753 of 6zngF
Sites not aligning to the query:
4v12A Crystal structure of the msmeg_6754 dehydratase from mycobacterium smegmatis (see paper)
31% identity, 16% coverage: 22:98/483 of query aligns to 200:277/337 of 4v12A
Sites not aligning to the query:
>AZOBR_RS12500 FitnessBrowser__azobra:AZOBR_RS12500
MDRVIAPATPDFGKNGSAMIENVTFEEIQIGQQASLSRRLTMSDIELFATVSGDINPAHL
DEEYAADSQFHKVIGHGMWSGSLISAVLGTLLPGPGTIYMGQDLRFKRPVGLGDVITVTV
TAKEKHAEKNIVVFDCVARNQDGKEVVSGLAEVIAPTRKVRRAAHELPQVQVIRHDGHDE
LLGKTETLPPVPTAVVHPCDESSLKGAVEAAEANLIDPVLIGPASKIKSVAEAHGLDISR
YRIVDVAHSHASAETGVRLARSGECEAVMKGSLHTDELMAEVVRKETGLRTGRRLSHVFV
MNVPTYPRTLLITDAAINIYPTLEDKVDIVQNAIDLAKVLGVETPRVAILSAVETVNPKI
ASTLEAAALCKMADRGQIKGGILDGPLAFDNAISLEAARTKGIVSEVAGQADVLLVPDLE
AGNMLAKQLSFLANSDAAGIVLGARVPIILTSRADNVRTRLASCAVAVLAAAARRRGAAT
AAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory