SitesBLAST
Comparing AZOBR_RS12675 FitnessBrowser__azobra:AZOBR_RS12675 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
40% identity, 95% coverage: 4:271/283 of query aligns to 2:269/484 of 2cfoA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
40% identity, 95% coverage: 4:271/283 of query aligns to 3:270/485 of Q8DLI5
- R6 (= R7) binding
- Y192 (= Y194) binding
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
36% identity, 95% coverage: 4:273/283 of query aligns to 3:245/380 of 4g6zA
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
32% identity, 95% coverage: 4:273/283 of query aligns to 3:260/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
32% identity, 95% coverage: 4:273/283 of query aligns to 3:260/471 of P04805
- C98 (= C99) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C101) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (= C129) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ G131) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ S133) mutation to Q: No change in activity or in zinc content.
- H131 (≠ M135) mutation to Q: No change in activity or in zinc content.
- H132 (≠ E136) mutation to Q: No change in activity or in zinc content.
- C138 (≠ A142) mutation to S: No change in activity or in zinc content.
- S239 (≠ A252) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
32% identity, 95% coverage: 6:273/283 of query aligns to 4:273/485 of 4griB
- active site: S9 (= S11), K253 (= K253)
- binding glutamic acid: R5 (= R7), A7 (= A9), S9 (= S11), E41 (= E43), Y194 (= Y194), R212 (= R212), W216 (≠ L216)
- binding zinc ion: C105 (= C99), C107 (= C101), Y128 (= Y125), C132 (= C129)
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
31% identity, 95% coverage: 4:273/283 of query aligns to 103:355/564 of 3al0C
- active site: S110 (= S11), K335 (= K253)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R7), A108 (= A9), P109 (= P10), G118 (= G19), T122 (≠ S23), E142 (= E43), Y276 (= Y194), R294 (= R212), G295 (= G213), D297 (= D215), H298 (≠ L216), L324 (= L242), I325 (≠ L243), L333 (= L251)
- binding : T144 (≠ I45), D145 (= D46), R148 (= R49), Y208 (≠ C101), P213 (≠ I106), K252 (≠ R170), M255 (≠ Q173), I266 (≠ V184), K269 (≠ R187), S270 (≠ K188), Y276 (= Y194), D297 (= D215), H298 (≠ L216), L299 (≠ F217), S300 (≠ F218), N301 (≠ A219), K304 (≠ A222), R330 (≠ G248), P332 (≠ R250)
Sites not aligning to the query:
- binding : 363, 364, 365, 370, 387, 389, 391, 392, 397, 400, 407, 446, 447, 453, 457, 509, 520, 524, 527, 535, 536, 538, 539
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
33% identity, 98% coverage: 1:278/283 of query aligns to 1:279/488 of 8vc5A
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
37% identity, 92% coverage: 2:260/283 of query aligns to 14:248/308 of P27305
- E55 (= E43) binding
- Y182 (= Y194) binding
- R200 (= R212) binding
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
34% identity, 96% coverage: 4:274/283 of query aligns to 2:267/468 of 1g59A
- binding : D44 (= D46), R45 (≠ P47), A46 (≠ Q48), R47 (= R49), P109 (≠ R103), V145 (≠ A148), R163 (= R170), V166 (≠ Q173), E172 (≠ L179), V177 (= V184), K180 (≠ R187), S181 (≠ K188), D182 (= D189), E207 (≠ D214), E208 (≠ D215), R237 (≠ V244), K241 (≠ G248), T242 (≠ E249), K243 (≠ R250)
Sites not aligning to the query:
- binding : 273, 274, 282, 299, 300, 303, 304, 309, 312, 319, 357, 358, 417, 426, 427, 432, 435, 442, 443, 444, 445, 446, 447, 448
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
34% identity, 96% coverage: 4:274/283 of query aligns to 2:267/468 of 2cv2A
- active site: K246 (= K253)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R7), A7 (= A9), S9 (= S11), G17 (= G19), I21 (≠ S23), E41 (= E43), Y187 (= Y194), R205 (= R212), A206 (≠ G213), E208 (≠ D215), W209 (≠ L216), L235 (= L242), L236 (= L243)
- binding : S9 (= S11), T43 (≠ I45), D44 (= D46), R47 (= R49), V145 (≠ A148), R163 (= R170), Y168 (≠ A175), E172 (≠ L179), V177 (= V184), K180 (≠ R187), S181 (≠ K188), Y187 (= Y194), E207 (≠ D214), E208 (≠ D215), W209 (≠ L216), V211 (≠ F218), R237 (≠ V244), K241 (≠ G248)
Sites not aligning to the query:
- binding : 272, 273, 274, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 432, 435, 442, 443, 444, 446, 447, 448
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
34% identity, 96% coverage: 4:274/283 of query aligns to 2:267/468 of 2cv1A
- active site: K246 (= K253)
- binding adenosine-5'-triphosphate: P8 (= P10), S9 (= S11), G17 (= G19), T18 (≠ H20), I21 (≠ S23), R47 (= R49), A206 (≠ G213), W209 (≠ L216), L235 (= L242), L236 (= L243)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R7), A7 (= A9), E41 (= E43), Y187 (= Y194), R205 (= R212), W209 (≠ L216)
- binding : S9 (= S11), E41 (= E43), T43 (≠ I45), D44 (= D46), R47 (= R49), V145 (≠ A148), R163 (= R170), V166 (≠ Q173), E172 (≠ L179), V177 (= V184), K180 (≠ R187), S181 (≠ K188), Y187 (= Y194), E207 (≠ D214), E208 (≠ D215), W209 (≠ L216), V211 (≠ F218), R237 (≠ V244), K241 (≠ G248), K243 (≠ R250)
Sites not aligning to the query:
- binding : 273, 274, 276, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
34% identity, 96% coverage: 4:274/283 of query aligns to 2:267/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
34% identity, 96% coverage: 4:274/283 of query aligns to 2:267/468 of 1n78A
- active site: K246 (= K253)
- binding glutamol-amp: R5 (= R7), A7 (= A9), P8 (= P10), S9 (= S11), G17 (= G19), T18 (≠ H20), I21 (≠ S23), E41 (= E43), Y187 (= Y194), N191 (≠ V198), R205 (= R212), A206 (≠ G213), E208 (≠ D215), W209 (≠ L216), L235 (= L242), L236 (= L243)
- binding : S9 (= S11), T43 (≠ I45), D44 (= D46), R47 (= R49), V145 (≠ A148), R163 (= R170), V166 (≠ Q173), Y168 (≠ A175), E172 (≠ L179), V177 (= V184), K180 (≠ R187), S181 (≠ K188), Y187 (= Y194), E207 (≠ D214), E208 (≠ D215), W209 (≠ L216), L210 (≠ F217), V211 (≠ F218), R237 (≠ V244), K241 (≠ G248)
Sites not aligning to the query:
- binding : 273, 274, 282, 297, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
34% identity, 96% coverage: 4:274/283 of query aligns to 2:267/468 of 1j09A
- active site: K246 (= K253)
- binding adenosine-5'-triphosphate: H15 (= H17), E208 (≠ D215), L235 (= L242), L236 (= L243), K243 (≠ R250), I244 (≠ L251), S245 (≠ A252), K246 (= K253), R247 (= R254)
- binding glutamic acid: R5 (= R7), A7 (= A9), S9 (= S11), E41 (= E43), Y187 (= Y194), N191 (≠ V198), R205 (= R212), W209 (≠ L216)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
34% identity, 96% coverage: 4:274/283 of query aligns to 2:267/468 of P27000
Sites not aligning to the query:
- 358 R→Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
37% identity, 89% coverage: 2:254/283 of query aligns to 2:230/290 of 4a91A
- active site: S11 (= S11), K229 (= K253)
- binding glutamic acid: R7 (= R7), A9 (= A9), S11 (= S11), E43 (= E43), Y170 (= Y194), R188 (= R212), L192 (= L216)
- binding zinc ion: C99 (= C99), C101 (= C101), Y113 (= Y125), C117 (= C129)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
31% identity, 99% coverage: 4:282/283 of query aligns to 3:291/502 of 6brlA
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
32% identity, 96% coverage: 3:274/283 of query aligns to 10:271/455 of 3aiiA
1o0cA Crystal structure of l-glutamate and ampcpp bound to glutamine aminoacyl tRNA synthetase (see paper)
35% identity, 34% coverage: 2:97/283 of query aligns to 18:113/529 of 1o0cA
Sites not aligning to the query:
- binding adenosine monophosphate: 223, 253, 254, 263
- binding glutamic acid: 204, 208, 222
- binding : 6, 119, 123, 126, 128, 129, 130, 161, 174, 175, 176, 185, 187, 203, 204, 226, 227, 228, 231, 306, 309, 310, 311, 313, 314, 316, 318, 319, 322, 329, 334, 362, 392, 394, 395, 403, 405, 406, 435, 499, 501, 502, 527
Query Sequence
>AZOBR_RS12675 FitnessBrowser__azobra:AZOBR_RS12675
MTDVVTRFAPSPTGHLHLGHAHSALFGWTTARKAGGRFLLRIEDIDPQRCRPEFDRDLRE
DLAWLGLTWEEPVRRQSEHLDDYRAALARLADLGVVYPCFCTRKDIAAEIARAGHAPHGP
DGPLYPGTCRGLSDMERQDRIAAGAAYAVRLDVGKAMAMTGPLRWHDRRRGWQDAMPSLL
GDIVLARKDVPTSYHLAVTLDDHLQGVTLVTRGDDLFFATNAHRLLQELLRVVPPDYDHH
PLLVNERGERLAKRDNAKTLRSLRELGLTPAAVRASAGFPEEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory