Comparing AZOBR_RS14135 FitnessBrowser__azobra:AZOBR_RS14135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
64% identity, 98% coverage: 3:201/203 of query aligns to 539:734/758 of O14289
Sites not aligning to the query:
P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 95% coverage: 1:192/203 of query aligns to 1:185/198 of P9WK95
Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
35% identity, 66% coverage: 18:151/203 of query aligns to 13:126/170 of Q58667
2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud) from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
35% identity, 66% coverage: 18:151/203 of query aligns to 13:126/167 of 2pkpA
P20004 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Bos taurus (Bovine) (see 2 papers)
44% identity, 25% coverage: 70:119/203 of query aligns to 658:707/780 of P20004
Sites not aligning to the query:
5acnA Structure of activated aconitase. Formation of the (4fe-4s) cluster in the crystal (see paper)
42% identity, 25% coverage: 70:119/203 of query aligns to 631:680/754 of 5acnA
Sites not aligning to the query:
>AZOBR_RS14135 FitnessBrowser__azobra:AZOBR_RS14135
MEKFTVLTGVAAPLPMINVDTDMIIPKQFLKTIKRTGLGKHLFDEMRYTPDGAEVAEFVL
NKPAYRSAKILVSGDNFGCGSSREHAPWALADFGIRCIIAPSFADIFFNNCFKNGILPIK
LPKEQVDLLLDDASRGSNAIVSVDLEKQEITGPDGGKISFEVDPFRKHCLLNGLDDIGLT
MQQAAFIDQYEGKQRGGQPWLWG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory