SitesBLAST
Comparing AZOBR_RS14455 AZOBR_RS14455 D-amino acid aminotransferase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P19938 D-alanine aminotransferase; D-amino acid aminotransferase; D-amino acid transaminase; DAAT; D-aspartate aminotransferase; EC 2.6.1.21 from Bacillus sp. (strain YM-1) (see 5 papers)
41% identity, 94% coverage: 8:277/287 of query aligns to 7:273/283 of P19938
- Y32 (= Y33) binding
- R51 (= R52) binding
- R99 (= R100) binding
- H101 (≠ F102) binding
- K146 (= K148) active site, Proton acceptor; modified: N6-(pyridoxal phosphate)lysine
- E178 (= E181) binding ; mutation to K: Loss of transaminase activity and small gain in racemase activity.
- L202 (= L206) mutation to A: Inactivates enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3lqsA Complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta) (see paper)
41% identity, 94% coverage: 8:277/287 of query aligns to 6:272/280 of 3lqsA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K148), E177 (= E181), L201 (= L206)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: V33 (= V35), R50 (= R52), E177 (= E181), S180 (= S184), S181 (= S185), N182 (= N186), L201 (= L206), G203 (= G208), I204 (= I209), T205 (= T210), S240 (= S245), T241 (≠ A246), T242 (≠ G247)
3daaA Crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine (see paper)
41% identity, 94% coverage: 8:277/287 of query aligns to 6:272/277 of 3daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K148), E177 (= E181), L201 (= L206)
- binding n-(5'-phosphopyridoxyl)-d-alanine: Y31 (= Y33), R50 (= R52), K145 (= K148), E177 (= E181), S180 (= S184), S181 (= S185), L201 (= L206), G203 (= G208), I204 (= I209), T205 (= T210), S240 (= S245), T241 (≠ A246)
2daaA Crystallographic structure of d-amino acid aminotransferase inactivated by d-cycloserine
41% identity, 94% coverage: 8:277/287 of query aligns to 6:272/277 of 2daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K148), E177 (= E181), L201 (= L206)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Y31 (= Y33), V33 (= V35), R50 (= R52), R98 (= R100), H100 (≠ F102), K145 (= K148), E177 (= E181), S180 (= S184), S181 (= S185), N182 (= N186), L201 (= L206), G203 (= G208), I204 (= I209), T205 (= T210), T241 (≠ A246)
1daaA Crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate (see paper)
41% identity, 94% coverage: 8:277/287 of query aligns to 6:272/277 of 1daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K148), E177 (= E181), L201 (= L206)
- binding pyridoxal-5'-phosphate: R50 (= R52), K145 (= K148), E177 (= E181), S180 (= S184), S181 (= S185), L201 (= L206), G203 (= G208), I204 (= I209), T205 (= T210), S240 (= S245), T241 (≠ A246)
1a0gB L201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate (see paper)
41% identity, 94% coverage: 8:277/287 of query aligns to 6:272/282 of 1a0gB
- active site: Y31 (= Y33), V33 (= V35), K145 (= K148), E177 (= E181), A201 (≠ L206)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R50 (= R52), K145 (= K148), E177 (= E181), S180 (= S184), S181 (= S185), G203 (= G208), I204 (= I209), T205 (= T210), S240 (= S245), T241 (≠ A246)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
30% identity, 99% coverage: 4:286/287 of query aligns to 3:287/290 of 5mr0D
- active site: F32 (≠ Y33), G34 (≠ V35), K150 (= K148), E183 (= E181), L206 (= L206)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R52), G100 (vs. gap), L101 (vs. gap), K150 (= K148), Y154 (≠ L152), E183 (= E181), G186 (≠ S184), D187 (≠ S185), L206 (= L206), I209 (= I209), T210 (= T210), G245 (≠ S245), T246 (≠ A246)
6fteB Crystal structure of an (r)-selective amine transaminase from exophiala xenobiotica
32% identity, 95% coverage: 5:277/287 of query aligns to 30:305/321 of 6fteB
- active site: Y58 (= Y33), K179 (≠ P138), E212 (= E181), L234 (= L206)
- binding pyridoxal-5'-phosphate: R77 (= R52), K179 (≠ P138), E212 (= E181), F216 (≠ S185), N217 (= N186), L234 (= L206), G236 (= G208), V237 (≠ I209), T238 (= T210), T274 (≠ A246)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
32% identity, 95% coverage: 6:277/287 of query aligns to 6:278/290 of 5e25A
- active site: F33 (≠ Y33), G35 (≠ V35), K151 (= K148), E184 (= E181), L207 (= L206)
- binding 2-oxoglutaric acid: Y88 (≠ S88), K151 (= K148), T247 (≠ A246), A248 (≠ G247)
- binding pyridoxal-5'-phosphate: R52 (= R52), K151 (= K148), Y155 (≠ L152), E184 (= E181), G187 (≠ S184), D188 (≠ S185), L207 (= L206), G209 (= G208), I210 (= I209), T211 (= T210), G246 (≠ S245), T247 (≠ A246)
6xwbA Crystal structure of an r-selective transaminase from thermomyces stellatus. (see paper)
33% identity, 95% coverage: 5:277/287 of query aligns to 30:304/319 of 6xwbA
- binding pyridoxal-5'-phosphate: R77 (= R52), K178 (≠ P138), F185 (≠ C145), E211 (= E181), G214 (≠ S184), F215 (≠ S185), N216 (= N186), L233 (= L206), G235 (= G208), V236 (≠ I209), T237 (= T210), T273 (≠ A246)
7p3tB Transaminase of gamma-proteobacterium (see paper)
34% identity, 95% coverage: 6:277/287 of query aligns to 7:279/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R52), K153 (= K148), R157 (≠ L152), E186 (= E181), S187 (≠ G182), A188 (≠ S183), A189 (≠ S184), S190 (= S185), G210 (= G208), I211 (= I209), T212 (= T210), T248 (≠ A246)
7z79B Crystal structure of aminotransferase-like protein from variovorax paradoxus
34% identity, 97% coverage: 6:283/287 of query aligns to 19:297/306 of 7z79B
- binding pyridoxal-5'-phosphate: W46 (≠ Y33), R65 (= R52), N166 (≠ K148), S202 (= S184), T203 (≠ S185), F222 (≠ L206), G224 (= G208), I225 (= I209), T226 (= T210), G261 (≠ S245), T262 (≠ A246)
4uugA The (r)-selective amine transaminase from aspergillus fumigatus with inhibitor bound (see paper)
29% identity, 95% coverage: 5:277/287 of query aligns to 29:304/320 of 4uugA
- active site: Y57 (= Y33), K178 (≠ P138), E211 (= E181), L233 (= L206)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R76 (= R52), K178 (≠ P138), E211 (= E181), G214 (≠ S184), F215 (≠ S185), N216 (= N186), L233 (= L206), G235 (= G208), I236 (= I209), T237 (= T210), T272 (≠ S245), T273 (≠ A246), A274 (≠ G247)
4chiA (R)-selective amine transaminase from aspergillus fumigatus at 1.27 a resolution (see paper)
29% identity, 95% coverage: 5:277/287 of query aligns to 29:304/320 of 4chiA
- active site: Y57 (= Y33), K178 (≠ P138), E211 (= E181), L233 (= L206)
- binding pyridoxal-5'-phosphate: R76 (= R52), K178 (≠ P138), E211 (= E181), F215 (≠ S185), L233 (= L206), G235 (= G208), I236 (= I209), T237 (= T210), T272 (≠ S245), T273 (≠ A246)
- binding phosphate ion: R76 (= R52), G235 (= G208), I236 (= I209), T237 (= T210), T273 (≠ A246)
4ce5B First crystal structure of an (r)-selective omega-transaminase from aspergillus terreus (see paper)
32% identity, 97% coverage: 5:283/287 of query aligns to 32:314/325 of 4ce5B
- active site: Y60 (= Y33), K180 (≠ P138), E213 (= E181), L235 (= L206)
- binding calcium ion: D67 (= D40), R69 (= R42)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: V62 (= V35), R79 (= R52), K180 (≠ P138), W184 (= W142), E213 (= E181), G216 (≠ S184), F217 (≠ S185), N218 (= N186), L235 (= L206), G237 (= G208), V238 (≠ I209), T239 (= T210), T274 (≠ S245), T275 (≠ A246), A276 (≠ G247)
- binding pyridoxal-5'-phosphate: R79 (= R52), K180 (≠ P138), E213 (= E181), G216 (≠ S184), F217 (≠ S185), L235 (= L206), G237 (= G208), V238 (≠ I209), T239 (= T210), T275 (≠ A246)
4ce5A First crystal structure of an (r)-selective omega-transaminase from aspergillus terreus (see paper)
32% identity, 97% coverage: 5:283/287 of query aligns to 32:314/325 of 4ce5A
- active site: Y60 (= Y33), K180 (≠ P138), E213 (= E181), L235 (= L206)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: Y60 (= Y33), V62 (= V35), R79 (= R52), K180 (≠ P138), W184 (= W142), E213 (= E181), G216 (≠ S184), F217 (≠ S185), N218 (= N186), L235 (= L206), G237 (= G208), V238 (≠ I209), T239 (= T210), T274 (≠ S245), T275 (≠ A246)
- binding pyridoxal-5'-phosphate: R79 (= R52), K180 (≠ P138), E213 (= E181), F217 (≠ S185), L235 (= L206), G237 (= G208), V238 (≠ I209), T239 (= T210), T275 (≠ A246)
6xu3B (R)-selective amine transaminase from shinella sp. (see paper)
31% identity, 96% coverage: 5:279/287 of query aligns to 29:305/321 of 6xu3B
- active site: Y57 (= Y33), K177 (≠ P138), E210 (= E181), L232 (= L206)
- binding 3-aminobenzoic acid: P169 (vs. gap), D173 (vs. gap), K229 (≠ Q203)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: R76 (= R52), Y112 (≠ S88), K177 (≠ P138), F184 (≠ C145), E210 (= E181), G213 (≠ S184), F214 (≠ S185), N215 (= N186), L232 (= L206), G234 (= G208), V235 (≠ I209), T236 (= T210), T272 (≠ S245)
6xu3A (R)-selective amine transaminase from shinella sp. (see paper)
31% identity, 96% coverage: 5:279/287 of query aligns to 28:304/320 of 6xu3A
- active site: Y56 (= Y33), K176 (≠ P138), E209 (= E181), L231 (= L206)
- binding pyridoxal-5'-phosphate: R75 (= R52), K176 (≠ P138), F183 (≠ C145), E209 (= E181), G212 (≠ S184), F213 (≠ S185), L231 (= L206), G233 (= G208), V234 (≠ I209), T235 (= T210), T271 (≠ S245)
6xu3C (R)-selective amine transaminase from shinella sp. (see paper)
31% identity, 96% coverage: 5:279/287 of query aligns to 30:306/322 of 6xu3C
- active site: Y58 (= Y33), K178 (≠ P138), E211 (= E181), L233 (= L206)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: V60 (= V35), R77 (= R52), K178 (≠ P138), F185 (≠ C145), E211 (= E181), G214 (≠ S184), N216 (= N186), L233 (= L206), G235 (= G208), V236 (≠ I209), T237 (= T210), T272 (≠ S244), T273 (≠ S245), A274 (= A246)
6snlD (R)-selective amine transaminase from exophiala sideris (see paper)
30% identity, 95% coverage: 5:277/287 of query aligns to 29:304/320 of 6snlD
- active site: Y57 (= Y33), K178 (≠ P138), E211 (= E181), L233 (= L206)
- binding pyridoxal-5'-phosphate: R76 (= R52), K178 (≠ P138), E211 (= E181), G214 (≠ S184), F215 (≠ S185), L233 (= L206), G235 (= G208), V236 (≠ I209), T237 (= T210), T273 (≠ A246)
Query Sequence
>AZOBR_RS14455 AZOBR_RS14455 D-amino acid aminotransferase
MARWAYVNGRYLPHRQAAVHVEDRGFQFADGVYEVVTLLDGRFADLDGHMERLGRSLSEL
RMDWPAAPRVVTMIARELVRRNGVRNGSLYIQVTRGVAPRDFKFPASVSATLVMTVKRVT
AFAKPEQLEKGVAVVTVPDIRWGRCDIKTVGLLAPVLAKQQAAESGAYEAWLIDPDGTVT
EGSSSNAWIVTQDGVLVTRAPSQKILNGITRLSLLRLAGERGIPVEERSFTVEEALAARE
AFVSSAGTFALPVTRIDGKPVGEGKPGPVTRTLRQAYLDYVAAGVPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory