Comparing AZOBR_RS14580 FitnessBrowser__azobra:AZOBR_RS14580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
30% identity, 87% coverage: 34:378/398 of query aligns to 8:337/358 of P45131
Sites not aligning to the query:
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
31% identity, 92% coverage: 32:397/398 of query aligns to 9:371/374 of D2Z028
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
34% identity, 79% coverage: 34:347/398 of query aligns to 3:301/346 of 5w8oB
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 71% coverage: 32:312/398 of query aligns to 82:352/504 of Q10341
Sites not aligning to the query:
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
33% identity, 82% coverage: 22:347/398 of query aligns to 5:317/368 of 7rytB
Sites not aligning to the query:
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
33% identity, 82% coverage: 22:347/398 of query aligns to 5:317/367 of 8f2lA
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
33% identity, 82% coverage: 22:347/398 of query aligns to 6:318/366 of 6puxA
Sites not aligning to the query:
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
32% identity, 87% coverage: 31:378/398 of query aligns to 10:344/366 of 6ioiA
Sites not aligning to the query:
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
32% identity, 87% coverage: 31:378/398 of query aligns to 10:344/375 of 6iohA
Sites not aligning to the query:
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
28% identity, 90% coverage: 40:398/398 of query aligns to 18:347/347 of 2vatA
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
28% identity, 90% coverage: 40:396/398 of query aligns to 19:347/350 of 2vavB
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
31% identity, 93% coverage: 28:396/398 of query aligns to 9:372/387 of Q6FEQ3
>AZOBR_RS14580 FitnessBrowser__azobra:AZOBR_RS14580
MRSLAKRLGGLALAAGLFCAAPALAFEGLVEKKVFEMPSYTTVGGGTIKNVRIGWESYGK
LNDARDNVILVTHFFSGNSHAAGKYKMEDPAPGYWDSIIGPGKPLDTDKFFIISSDTLVN
LSPKDPTVTTTGPASVNPDTGKPYGMSFPVVTIRDFVNVQKALLDSLNVKSLHAVMGGSM
GSLQALEWGATHPEMVKRVVAVIGGAEADPFLIGWLNLWAAPIRVDPNWQGGDYYGKAEP
KAGLTEALKLVTLHARHWKWADATFGRGWAEEGKDPAASMNNQYAIEAWLDKAAAARAAV
SDANHFLYLVKANQTFLVGGGGSLDEGLAKIKAPVLLIPSADDLVFPPERAMRPLKERLE
KQGIAVTYTDAITTSLGHLDGIANIAKAGDAISAFMAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory